(data stored in ACNUC7421 zone)

EMBL: CP002047.PE279

CP002047.PE279       Location/Qualifiers
FT   CDS_pept        complement(306966..307424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00279"
FT                   /product="ROK family protein"
FT                   /note="COG1940 Transcriptional regulator/sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00279"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03400"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWP4"
FT                   /protein_id="ADI03400.1"
FT                   /translation="MRGANGLAGELSHLHADSAGPMCRCGARGCLGVVATTDHVLEAAR
FT                   PLFGPDVNIYDVLGLAAQGEATVRRVLDDFGRLVGRHLAPACVMLNPELIVVDGTLGPA
FT                   AAPVMEGLHDGLRRHMPDGAYRALTLTLGRLAENAELLGAAHLARAPM"
     gtgcgcggag cgaacggcct ggccggcgag ttgtcccatc tccatgccga ctcggcaggc        60
     cccatgtgcc gctgcggtgc ccgcggctgc ctcggcgtgg tcgccaccac cgaccatgtc       120
     ctggaagccg cccgcccgct gttcggcccg gacgtgaaca tctacgacgt cctcggcctc       180
     gccgcgcagg gcgaggcgac cgtccgccga gtcctcgacg acttcggccg cctcgtcgga       240
     cgccacctcg cccccgcctg cgtcatgctc aaccccgagt tgatcgtcgt ggacggcaca       300
     ctcggccccg ccgccgctcc cgtcatggag ggccttcacg acgggttgcg ccgccacatg       360
     cccgacgggg cctaccgcgc gctgaccctc accctcggcc gactggccga aaacgccgaa       420
     ctcctcggag ccgcgcatct cgcacgagcc ccgatgtag                              459
//

If you have problems or comments...

PBIL Back to PBIL home page