(data stored in ACNUC7421 zone)

EMBL: CP002047.PE28

CP002047.PE28        Location/Qualifiers
FT   CDS_pept        complement(24142..24480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00028"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03149"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSX2"
FT                   /protein_id="ADI03149.1"
FT                   /translation="MSINRRAAVVAASLGITTGGLFLAAAPASASAQDIWTCNPPQYMT
FT                   GSGGHAGASLQCFGTSWDDAFNVAVTCKRWDNGYEYRHDGPKVQTGQVSTVWCDLNAGI
FT                   VHLAYVAW"
     atgtccatca accgacgtgc cgcagtggtc gcggcatcgc tcggcatcac aacgggcggg        60
     ctgttcctgg cagccgcccc cgcctccgcc tccgcccagg acatctggac gtgcaatccg       120
     ccgcagtaca tgacgggcag cggcggacac gccggcgcct cgctccagtg tttcggcacc       180
     agctgggacg acgctttcaa cgtcgccgtc acgtgcaagc ggtgggacaa cggatacgag       240
     taccgtcacg acgggcccaa ggtccagacg ggccaggtct ccaccgtgtg gtgcgacctg       300
     aacgcgggaa tcgtgcacct cgcctacgtg gcctggtag                              339
//

If you have problems or comments...

PBIL Back to PBIL home page