(data stored in ACNUC7421 zone)

EMBL: CP002047.PE282

CP002047.PE282       Location/Qualifiers
FT   CDS_pept        308872..310002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00282"
FT                   /product="putative oxidoreductase transmembrane protein"
FT                   /note="COG0654 2-polyprenyl-6-methoxyphenol hydroxylase and
FT                   related FAD-dependent oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00282"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03403"
FT                   /db_xref="GOA:D7BWP7"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWP7"
FT                   /protein_id="ADI03403.1"
FT                   /translation="MIVGSGISGLAAALTLHRAGWQPLIVERAPRRRTGGYFVRFFGPG
FT                   YAAAERLGILDALPQRTLPDGRMYEIARSGRVTPGITFPNQVDGTPLRILLRSDLERVL
FT                   YDEVHDLVEIRYGIGPAAITQDRHQVTVTMTDGSVETADLLIGADGIHSTVRSLVFGPE
FT                   DLYRKDFDHAVAACVIDGELPGVRDGDTLVATAPGRSAWINTYVDHPPVAFLLYRTPWP
FT                   AAEVRRNPSEALREAFGDFGGAVVPAMLDALDRSESVLFDQVSQIHINRWSQGRVVLLG
FT                   DSAWCMTLYSGQGSGMGIAGAELLGRLLGERADIPAALGAWEQQLRPLTTRYQKQALFM
FT                   QHMFMPVNRFGHLARRTAIRAISSPVGVKIAKAVKR"
     gtgatcgtcg gctccggcat atccggactc gccgcggccc tgaccctgca ccgcgccggc        60
     tggcagcccc tgatcgtcga acgcgcgccc cggcgccgta ccggcggcta cttcgtccgt       120
     ttcttcggcc ccggctacgc cgccgccgaa cgcctgggca tcctggacgc gctcccccag       180
     cgcaccctcc ccgacgggcg catgtacgag atcgcccgca gcggccgcgt cacccccggc       240
     atcacctttc cgaaccaggt cgacggcacc ccgctgcgga tcctgctccg cagcgacctg       300
     gaacgcgtcc tgtacgacga ggtccacgac ctggtcgaga tccgctacgg gatcgggccc       360
     gccgccatca cccaggaccg ccaccaagtg accgtcacca tgaccgacgg ttcggtggag       420
     accgcggacc tgctcatcgg cgccgacggt atccactcca ccgtccgctc cctggtcttc       480
     ggcccggaag acctctaccg caaggacttc gaccacgccg tggccgcctg cgtcatcgac       540
     ggtgagctgc ccggcgtacg cgacggcgac accctggtcg ccaccgcccc cggccgctcg       600
     gcctggatca acacctacgt cgaccatccc ccggtggcct tcctgctcta ccgcacgccc       660
     tggcccgccg cggaggtccg caggaacccc tccgaggctc tgcgcgaggc gttcggcgac       720
     ttcggcggcg ccgtcgtgcc ggccatgctg gacgccctgg accgctccga gtccgtgctc       780
     ttcgaccagg tcagccagat ccacatcaac cgctggagcc agggccgggt ggtcctgctc       840
     ggcgactccg cgtggtgtat gaccctctac tcaggacagg gctcgggcat gggcatcgcc       900
     ggcgccgagc tgctgggccg gctgctgggc gagcgcgccg acatccccgc cgccctcggc       960
     gcctgggagc agcagctgcg cccgctgacc acccgctacc agaagcaggc gctgttcatg      1020
     cagcacatgt tcatgcccgt caaccggttc ggacacctcg cccgccgtac cgccatccgc      1080
     gcgatctcca gcccggtcgg cgtcaagatc gccaaggccg tcaagcgctg a               1131
//

If you have problems or comments...

PBIL Back to PBIL home page