(data stored in ACNUC7421 zone)

EMBL: CP002047.PE283

CP002047.PE283       Location/Qualifiers
FT   CDS_pept        310170..311573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00283"
FT                   /product="putative transport integral membrane protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00283"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03404"
FT                   /db_xref="GOA:D7BWP8"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWP8"
FT                   /protein_id="ADI03404.1"
FT                   /translation="MAQLMVVLDATIVNIALPSAQQDLGFTDGNRQWIVTAYALAFGSL
FT                   LLLGGRIADLFGRKMTFLVGLVGFAGASAFGGAATSFDMLVAARALQGVFGALLAPAAL
FT                   SLLTVTFTDARERAKAFGVYGAIAGSGGAIGLLLGGVLTEHLDWRWTLYVNLAFAVVAV
FT                   IGGAVLLQRSTRDTSVTIDIPGAVLVGGGLFCLVYGFSNAESHDWDSPATFGFLAAGAV
FT                   LLAAFTWWQTRSPHPLLPLRILLDRNRGASFVSVLISGAGMFGVFLFLTYYLQQSLGYT
FT                   PIRTGLAFLPMVAALMLTSTLATTALIPRLGPKPVVPLGMGLAAAGMAWLTALDLDSGY
FT                   AADILPPLVVAGLGLGLVMAPAMSLATSGVAAEDSGVASAAVNTMQQVGGSLGTALLNT
FT                   LSTSAVTNYLDGKNPKDPAVLAHAGLEGYSTAYWWSAVFFAAGVVISALLYRRGAPAQD
FT                   AAAAPVVHM"
     gtggcccagc tgatggtcgt cctggacgcc accatcgtga acatcgccct gccctcggca        60
     cagcaggact tgggcttcac cgacggcaac cggcagtgga tcgtcaccgc ctacgccctc       120
     gccttcggca gtctgctgct gctcggcggc cgcatcgccg acctcttcgg ccgcaaaatg       180
     accttcctcg tcgggctggt cggcttcgcc ggggcctccg ccttcggcgg cgccgccacc       240
     agcttcgaca tgctcgtcgc cgcccgcgcc ctccagggcg tgttcggcgc gctgctcgcc       300
     ccggcggccc tctccctgct gaccgtcacc ttcaccgacg ccagggaacg agccaaggcc       360
     ttcggcgtat acggcgccat cgccggttcc gggggcgcca tcggtctgct cctgggcggt       420
     gtgctgaccg aacacctcga ctggcgctgg accctttacg tcaacctcgc cttcgccgtc       480
     gtcgccgtca tcggcggtgc ggtcctgctg caacgctcca cccgcgacac cagcgtcacc       540
     atcgacatcc ccggcgccgt cctcgtcggt ggcggactgt tctgcctggt ctacggcttc       600
     tccaacgccg agagccacga ttgggactcc cccgccacct tcggtttcct ggccgccgga       660
     gccgttctgc tcgccgcctt cacctggtgg cagacccgct ccccgcaccc cctgctgccg       720
     ctgcgcatcc tgctcgaccg caaccgcggc gcctccttcg tctccgtcct gatcagcggc       780
     gccgggatgt tcggggtctt cctcttcctc acctactacc tgcagcagag cctcggctac       840
     acccccatca ggaccggcct ggccttcctg cccatggtcg ccgccctcat gctcacctcc       900
     accctcgcca ccaccgcact catcccgcgc cttggcccca agcccgtggt gcccctcggc       960
     atgggcctgg ccgccgccgg catggcctgg ctgaccgccc tcgacctgga cagcggctac      1020
     gcggccgaca tcctgccccc gctggtcgtg gccggcctcg gcctcggcct ggtgatggcc      1080
     cccgcgatga gcctggccac ctccggggtg gccgccgagg actccggcgt cgcctcggcc      1140
     gccgtcaaca ccatgcagca ggtcggcggc tcgctcggca ccgccctgct caacaccctg      1200
     tccaccagcg ccgtcaccaa ctacctggac ggcaagaacc ccaaggaccc cgccgtcctc      1260
     gcccacgccg gtctggaggg ctactccacg gcctactggt ggtcggccgt cttcttcgcc      1320
     gccggtgtgg tcatcagcgc cctcctctac cgacgcggcg cacccgccca ggacgccgcc      1380
     gcggcacccg tcgtacacat gtga                                             1404
//

If you have problems or comments...

PBIL Back to PBIL home page