(data stored in ACNUC7421 zone)

EMBL: CP002047.PE285

CP002047.PE285       Location/Qualifiers
FT   CDS_pept        314273..316723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00285"
FT                   /product="hypothetical protein"
FT                   /note="COG1554 Trehalose and maltose hydrolases (possible
FT                   phosphorylases)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00285"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03406"
FT                   /db_xref="GOA:D7BWQ0"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR017045"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWQ0"
FT                   /protein_id="ADI03406.1"
FT                   /translation="MSRTPPGWTWAYEGYDPAEERLRESLCTLGNGYFATRGALPECGA
FT                   DAVHSPGTYAAGCYNRLESQVAGRRVENEDLVNLPNWLPLRFRPGGEDTAGNSPTPWLS
FT                   PDTHPPLDHRLTLDLRTGILERATRYVDDAGRHLAVRQLRLVHMGDPHLAALRTEFTAE
FT                   DWSGPLEVESALDGAVANTGVARYRQLANRHLTHVHTGTAPSRDVVWLRCRTTTSDIRV
FT                   GMAARTTTDGDTDTTTTHSPERACLLLRPLMEPGRTVTVDKCVALHTSRDPAISDPLHA
FT                   AVDRVGRAPDFEALADAHRAAWEQLWRAGEMDVPGQAGRILRLHLFHLLQTLSPHTADL
FT                   DVGVPARGLHGEAYRGHVFWDELFVLPYLNLHLPEVSRALLDYRHRRLERACFAARDAG
FT                   RAGAMYPWQSGSDGREETQRLHLNPRSGRWLPDHSRLQHHVGSAIAYNVWQYGEATGDA
FT                   EFMHTKGAEMLLQIARFWADAATWDKARGRYRILGVVGPDEYHDGYPGASRPGIDDNTY
FT                   TNVTAAWVLARALDLLRSLPEPRRRDLFERTALADAELDIWQDVSRRLLVPWHRGIVSQ
FT                   FDGYGELAEFDWDRYRKAYGDIRRLDRILEAEGDTVNRYQASKQADVLMLGYLFAPAEL
FT                   RGLFRRLGHELDDTTWRRTVDYYLHRTSHGSTLSSLVHAWVLPRVRRAEAWRFCQEALT
FT                   GDIADLQGGTTGEGIHLGAMAGTLDLVQRGLTGLEPRGGVLRLDPAPLPELSRFGLSIR
FT                   YRGHWGVRLRLSAGQLHITVPASDRGPIDVALGDCTVSVPPGETCLLPLPQGADGLSMH
FT                   TAYP"
     atgagccgga caccacccgg gtggacctgg gcgtacgagg gctacgaccc ggccgaggag        60
     cggctgaggg agtccctgtg caccctcggc aacggctact tcgcgacccg gggcgccctt       120
     ccggagtgcg gcgcggatgc cgtgcacagc cccggtacct acgcggccgg gtgttacaac       180
     cggctggagt cacaggtggc gggccggcgg gtggagaacg aggacctggt caacctgccc       240
     aactggctgc cgctgcgttt ccggcccggc ggcgaggaca ccgccggcaa ctccccgaca       300
     ccgtggctct ccccggacac ccaccccccg ctcgaccacc ggctgaccct cgacctgcgc       360
     acgggcatcc tggaacgcgc cacgcgctac gtcgacgacg ccggccggca cctggccgtg       420
     cggcagctgc gcctcgtcca catgggcgac ccgcatctgg cggcgctgcg caccgagttc       480
     accgcggagg actggtcggg gccgctggag gtggagtcgg cgctggacgg cgcggtggcc       540
     aacaccggcg tcgcccggta ccggcagctg gccaaccggc acctgaccca tgtgcacacg       600
     ggcaccgcgc ccagccgtga tgtggtctgg ctgcgctgcc gcaccaccac ctccgacatc       660
     cgcgtcggca tggccgcccg caccaccacc gacggcgaca ccgacacgac cacaacgcac       720
     tcgccggaac gcgcctgcct cctgctgcgg ccgctgatgg agccgggccg gacggtgacc       780
     gtcgacaagt gcgtcgccct gcacacctcc cgcgacccgg ccatcagcga tcccctgcac       840
     gccgccgtgg accgcgtggg tcgtgcgccg gacttcgagg cactcgccga cgcccaccgt       900
     gcggcgtggg agcagctgtg gcgcgcgggc gagatggacg tacccggtca ggcggggcgg       960
     atcctgcggc tgcatctgtt ccatctgctg cagacgctct ccccgcacac cgcggacctg      1020
     gatgtcgggg tgcccgcgcg cgggctgcac ggcgaggcgt accggggcca tgtgttctgg      1080
     gacgagctgt tcgtcctgcc ctatctgaac ctgcacctcc ccgaggtctc ccgggcgctg      1140
     ctggactacc gccaccgcag gctggagcgg gcgtgtttcg cggcccgcga cgccgggcgg      1200
     gcgggcgcga tgtacccgtg gcagagcggc agcgacggcc gtgaggagac ccagcggctg      1260
     catctcaatc cgcgctcggg acgctggctg cccgatcact cccggctcca gcaccatgtc      1320
     gggtcggcga tcgcgtacaa cgtgtggcag tacggcgagg ccaccgggga cgcggagttc      1380
     atgcacacca agggcgcgga gatgctgctg cagatcgccc ggttctgggc cgacgcggcc      1440
     acctgggaca aggcccgggg acggtatcgg atcctcggcg tggtcggccc cgacgagtat      1500
     cacgacggct accccggcgc ctcccgcccc ggcatcgacg acaacacgta caccaacgtc      1560
     accgccgcgt gggtgctcgc ccgcgccctc gatctgctgc ggtccctgcc cgaaccgcgc      1620
     cgccgggacc tgttcgaacg caccgcgctc gccgacgcgg agctcgacat ctggcaggac      1680
     gtctcccgga ggctgctggt gccctggcac cgcgggatcg tcagccagtt cgacggctac      1740
     ggggagctcg ccgagttcga ctgggaccgc tatcgcaagg cttacggcga catccggcgc      1800
     ctcgaccgga tcctggaggc cgagggcgac acggtcaacc gctaccaggc gtccaaacag      1860
     gccgatgtgc tcatgctcgg ctacctcttc gcgcccgccg agctccgcgg cctcttccgc      1920
     cggctcggcc acgagctgga cgacaccacc tggcggcgca ccgtcgacta ctacctgcac      1980
     cgcaccagcc acggttccac gctcagcagc ctcgtccacg cctgggtgct gccccgggtg      2040
     cggcgggccg aggcgtggcg cttctgtcag gaggcgctga ccggcgacat cgccgatctg      2100
     cagggcggca ccaccgggga gggcatccac ctcggcgcca tggccggcac cctcgacctc      2160
     gtacagcgcg gcctgaccgg actcgaaccc cggggcgggg tgctgcggct ggaccccgcg      2220
     ccactgcccg agctgtcccg gttcggactg tccatccgct accggggcca ctggggagtg      2280
     cggctgcggc tgagcgccgg gcagctgcac atcaccgtac cggcctccga ccgcggaccg      2340
     atcgacgtgg ccctgggcga ctgtacggtc tccgtgcccc cgggcgagac ctgcctgctg      2400
     cccctgccgc aaggagcgga cgggttatcc atgcacacgg cctatccatg a               2451
//

If you have problems or comments...

PBIL Back to PBIL home page