(data stored in ACNUC7421 zone)

EMBL: CP002047.PE286

CP002047.PE286       Location/Qualifiers
FT   CDS_pept        complement(316779..317654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00286"
FT                   /product="hypothetical protein"
FT                   /note="COG0589 Universal stress protein UspA and related
FT                   nucleotide-binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00286"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03407"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWQ1"
FT                   /protein_id="ADI03407.1"
FT                   /translation="MEEQVVTVGLDGSPESFAAARWAAAEAERRELALRLLHAWILLSP
FT                   PTPDSPPADDQNYWAKRIVHDARMELSRRHPDLPIEEELVAQEAETALLDAAARSRMLV
FT                   LGSRGMEPLASFFLGDISLYVVGRADRPVVLVRAGGVDEARTSGVRERDVVVGLSLHGP
FT                   QDNLLEFAYVTAFTRGVPLRAVHGRSLPVHAYVPWGVDPGIARDVAEEAQRELDEVLRP
FT                   WRKKFPRVEVVDEVRLESPAQAVVRAAGGSGLLMIGRRKHRSALAPRLGPVVQSAVHHA
FT                   RCPVAVVPHE"
     atggaggaac aggtcgtcac cgtgggcctc gacggatcgc cggagagctt tgccgccgct        60
     cgctgggccg ccgccgaggc ggagcggcgg gagctcgcgc tgcgtctgct gcacgcgtgg       120
     atcctgctgt ccccgcccac gccggacagc cccccggcgg atgaccagaa ctattgggcc       180
     aagcggatcg tgcacgacgc gcgcatggag ctcagccggc gccacccgga tctgcccatc       240
     gaggaggagc tggtcgcgca ggaggccgag acagccctgc tcgacgcggc ggcgcggtcc       300
     cggatgctgg tgctcggatc gcggggcatg gagcccttgg cgagcttctt cctcggtgac       360
     atcagcctct acgtggtcgg tcgggccgat cggccggtgg tcctggtgcg cgcgggcggc       420
     gtggacgagg cacggacgtc cggggtccgc gagcgggacg tggtggtcgg actgagtctg       480
     cacggccccc aggacaacct gctggaattc gcctacgtca ccgccttcac ccgcggtgtc       540
     ccgttgcgcg ccgtccacgg caggagcctg cccgtccacg cgtacgtccc gtggggcgtg       600
     gatcccggca tcgccagaga cgtcgccgag gaggcgcagc gggagctgga tgaggtgctg       660
     cggccgtggc ggaagaagtt tccccgtgtg gaggtggtcg acgaggtccg gctcgagagc       720
     ccggcgcaag ccgtcgtacg ggcggccggg ggcagcgggc tgctgatgat cggccgccgc       780
     aagcaccggt ccgccctggc gccccggctc ggcccggtgg tgcagtcggc cgtgcaccat       840
     gcccggtgtc cggtcgccgt ggtcccccat gaataa                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page