(data stored in ACNUC7421 zone)

EMBL: CP002047.PE287

CP002047.PE287       Location/Qualifiers
FT   CDS_pept        317783..318970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00287"
FT                   /product="hypothetical protein"
FT                   /note="COG0778 Nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00287"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03408"
FT                   /db_xref="GOA:D7BWQ2"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR015035"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWQ2"
FT                   /protein_id="ADI03408.1"
FT                   /translation="MPMLAHIGDHLIVESPTTGATRRDGEIVGVHHHDGTPPYDVRWSD
FT                   SGRVSLVFPGPDAHIQTEARASAWPLSDAEVAALVRDASAAPSMHNAQPWRFRYFRGKA
FT                   LFHVTADLARTLPHSDEDLRALHLGCGAALMNLRVAAAHTGRPPTTRLLPDPDEPTLLA
FT                   AVSLTGPPGDEEDLSALYPAVHTRHTSRAPFAETEIPEPVRTTLREAAGAEGVSLSFAS
FT                   GWHLQTVLDLTLEAEARNLTDSGSAEDLTHWARLSEQTPRSAAEGVPPYAFGPRRRGGK
FT                   APVRDFAGGKPIPGRESADFESSPQLALLATPGDTPKDWLRTGQAMERVLLTATLEGLS
FT                   SSFITQALEWPDLRWPLRDPMAGAGHVHMVLRLGYGPPGPRTPRRPTRHTLDIQP"
     atgccgatgc ttgctcatat cggcgaccac ctgattgtcg aaagccccac cacgggtgcg        60
     accaggcgcg acggcgagat cgtcggggtc catcaccacg acgggacgcc tccgtacgac       120
     gtgcgctggt cggattccgg acgggtctcc ctcgtgttcc ccggaccgga cgcccatatt       180
     cagacagaag cgcgtgcgag cgcatggccg ctctccgacg ccgaggtggc ggcgctggtg       240
     cgggatgcct cggccgcccc gtcgatgcac aacgcacagc cctggcggtt ccggtacttc       300
     cgcggcaagg ccctgttcca cgtcaccgcg gatctggcga ggaccctgcc gcactccgac       360
     gaggatctac gcgccctcca cctgggctgc ggcgccgccc tgatgaacct gcgcgtcgcg       420
     gccgcgcaca cgggccggcc accgacgacc cggctcctgc ccgaccccga cgagccgacc       480
     ctgctcgccg ccgtatcact gaccggccct cccggcgacg aagaagacct gagcgccctg       540
     tacccggccg tccacacccg gcacaccagc cgggccccgt tcgccgagac cgagataccc       600
     gaacccgtgc gcaccaccct ccgggaggcg gccggggcgg aaggtgtttc gttgtccttc       660
     gcctccgggt ggcatctgca gacggtgctg gatctgaccc tggaggccga ggcgcgcaac       720
     ctcaccgact cgggcagcgc cgaggacctc acccactggg cccggctctc cgagcagacg       780
     ccgcggtccg ccgccgaagg cgtaccgccg tacgccttcg gcccccgccg gcgcggcggc       840
     aaggcccccg tacgggactt cgcgggcggc aaaccgatcc ccggccgcga gagcgccgac       900
     ttcgaaagct ccccgcaact ggcgctgctg gccacccccg gcgacacacc gaaagactgg       960
     ctgcgcacgg gccaggccat ggaacgcgtc ctgctgaccg ccaccctcga aggactgtcc      1020
     agctccttca tcacccaggc cctcgaatgg cccgacctgc gctggccact gcgcgacccc      1080
     atggcaggag cgggacacgt acacatggtg ctgcgcctcg gctacggccc accaggcccc      1140
     agaacaccac gccgccccac ccgccacaca ctcgacatcc agccctga                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page