(data stored in ACNUC7421 zone)

EMBL: CP002047.PE289

CP002047.PE289       Location/Qualifiers
FT   CDS_pept        321399..321635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00289"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00289"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03410"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWQ4"
FT                   /protein_id="ADI03410.1"
FT                   /translation="MRSVGTVLALVVLATLVATFARRWRIPAPSLLVVAGLGVALLPGT
FT                   PQIEISPEVMGLGPPTAPRRSPPTSSTASSVAT"
     atgcgcagcg tcggtacggt cctggctctt gtcgtgctcg ccacgttggt ggcgaccttc        60
     gcccgccgat ggcgcatccc cgcaccgtcc ctgctggtcg tcgcgggcct cggcgtggcg       120
     ctgttgccgg gcaccccgca gatcgagatc agtcccgagg tcatggggct gggaccgccg       180
     acggcacctc gcaggagtcc gccgacctct tctaccgcca gctccgtcgc gacctga          237
//

If you have problems or comments...

PBIL Back to PBIL home page