(data stored in ACNUC7421 zone)

EMBL: CP002047.PE290

CP002047.PE290       Location/Qualifiers
FT   CDS_pept        322119..322640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00290"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03411"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWQ5"
FT                   /protein_id="ADI03411.1"
FT                   /translation="MSGSLGSHTALYLAAAEARRRGAELWPVLAWEPPGGELAANRTAA
FT                   TSPSALDWRRLARERLLTALDDVFGAAGPGVQLHALVACGAPGRALVGIADRENDVLVV
FT                   GAGRRGGLRRALRRSVSRYCLAHAACPVLAVPPSPLEAELTAVHRRNAWRLRLDTRDLG
FT                   DAAKTVPPDA"
     gtgagcggtt cgctggggag tcacaccgcg ctgtacctgg ccgccgccga ggcccggcgc        60
     cggggggccg aactgtggcc ggtcctcgcc tgggagccgc ccggcgggga actcgcggcg       120
     aaccggacgg cggccacctc ccccagtgcc ctcgactggc ggcgccttgc ccgggagagg       180
     ctgctcaccg cgctcgacga cgtgttcggc gccgctggtc ccggagttca gctgcacgcc       240
     ctggttgcct gtggcgcccc tggccgggcg ctggtgggga tcgccgaccg cgagaacgac       300
     gtcctggtcg tcggcgccgg tcggcgcggc ggcctgcgcc gcgcgctccg ccgctcggtc       360
     agccgctact gcctcgcgca cgcggcctgt cccgtcctcg cggtgccgcc gtccccgctg       420
     gaggccgagc tgacggccgt ccatcgccgc aacgcctggc ggctgcgcct ggacacccgg       480
     gatctggggg acgcggcgaa gaccgtgccg cccgacgcct ga                          522
//

If you have problems or comments...

PBIL Back to PBIL home page