(data stored in ACNUC7421 zone)

EMBL: CP002047.PE291

CP002047.PE291       Location/Qualifiers
FT   CDS_pept        complement(322661..325210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00291"
FT                   /product="two-component system sensor kinase for
FT                   high-affinity potassium transport system"
FT                   /note="COG2205 Osmosensitive K+ channel histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00291"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03412"
FT                   /db_xref="GOA:D7BWQ6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWQ6"
FT                   /protein_id="ADI03412.1"
FT                   /translation="MARGKFRIYLGAAPGVGKTYSMLSEAHRRVERGTDCVVAFVEHHH
FT                   RPRTEVMLHGLEQMPRKELEYRGGTFTEMDVDAVLARRPQVVLVDELAHTNVPGSRNAK
FT                   RWQDVEELLAAGIDVISTVNIQHLESLGDVVESITGIRQQETVPDEVVRRADQVELVDM
FT                   SPEALRRRMAHGNIYKPDKVDAALSNYFRPGNLTALRELALLWVADRVDEYLTEYRSEH
FT                   KVRAIWGSRERIVVGLTGGPEGRTLIRRAARLAEKGAGGEVMAVYIARSDGLASTSNSP
FT                   KELAVQRTLVEDLGGTFHHVVGDDVSAGLLDFARAVNATQIVLGVSRRKGWQYVFGPGV
FT                   GATVARESGPDLDVHLITHDEAGKGRGLPVARGARLGRTRIIGGWLAGVLGPALLTLLL
FT                   NGVVPEMGLANDMLLFLAMTVAAALLGGLLPALASAVVGSLLLNWFFTPPVHTLTIADP
FT                   KNIVAIAVFIGVAVSVASVVDLAARRTHQASRLRAESEILSFLTGNVLRGETSLDALLE
FT                   RVRETFGMESVALLERHSDVDPWTCAGSVGADPAQCPEDADVDVPVSEHMALALSGRVL
FT                   PAADRRVLAAFAAQAAVVLDRQRLQGEADQAKDLAEGNRIRTALLAAVSHDLRTPLAGI
FT                   KAAVSSLRSEDVAWSEEDQAELLEAIEEGADRLDLLVGNLLDMSRLQTGTVTPVIREAD
FT                   LDEVVPMALGGVPEGSVELDIPETLPMVHVDKGLLERAVANVVENAVKHSPPDRRVLVS
FT                   ASAMADRVEVRVVDRGPGVPDEAKDRIFEPFQRYGDSPRGTGVGLGLAVARGFVEAQGG
FT                   TLHAEDTPGGGLTMVLSVRTAPERRPEQPSLPAAATS"
     atggcacgcg gcaagtttcg gatctacctg ggcgcggcgc ccggcgtcgg caagacctac        60
     tcgatgctgt ccgaggcgca ccgccgcgtc gagcggggca cggactgcgt ggtggccttc       120
     gtcgagcacc accaccggcc gcgcaccgag gtgatgctgc acggcctgga gcagatgcca       180
     cgcaaagagc tggagtaccg gggcggcacc ttcaccgaga tggacgtcga cgccgtcctc       240
     gcccgccgcc cccaggtcgt cctcgtcgac gaactcgccc acaccaacgt ccccggctcg       300
     cgcaacgcca agcgctggca ggacgtcgag gaactgctcg cggccggcat cgacgtgatc       360
     tccacggtca acatccagca tctggagtcc ctgggtgacg tcgtcgagtc catcaccggc       420
     attcggcaac aggagaccgt ccccgacgag gtggtacgcc gcgccgacca ggtcgagctg       480
     gtcgacatgt ccccggaggc gctgcgccgc cggatggcgc acggcaacat atacaagccg       540
     gacaaggtcg acgccgcgct gtcgaactac ttccggcccg gcaatctgac cgcgctgcgc       600
     gagctggcgc tgctgtgggt cgccgaccgg gtggacgagt acctgaccga ataccgcagc       660
     gagcacaagg tccgggcgat ctggggctcg cgcgagcgga tcgtcgtcgg actgaccggc       720
     ggcccggaag gccgcaccct gatccggcgc gccgcgcgac tcgccgagaa gggcgccggc       780
     ggtgaggtga tggccgtcta catcgcccgc agcgacggcc tcgcctccac gtccaactcc       840
     ccgaaggaac tggccgtcca gcgcaccctc gtggaggacc tgggcggaac cttccaccac       900
     gtcgtcggcg acgacgtctc agcaggcctg ctggacttcg cacgcgcagt caacgccacc       960
     cagatcgtgc tcggcgtctc gcggcgcaag ggctggcagt acgtgttcgg ccccggtgtc      1020
     ggtgccaccg tcgcccgtga gtcggggccg gacctggacg tccacctgat cacccacgac      1080
     gaggcgggca agggccgcgg cctcccggtc gcccggggcg cgcggctcgg ccggacacgg      1140
     atcatcgggg gctggctcgc cggcgtgctc ggccccgccc tcctcaccct gctgctcaac      1200
     ggtgtcgtgc ccgagatggg cctcgccaac gacatgctgc tgttcctggc gatgacggtg      1260
     gcggcggcgc tgctgggcgg actgctgccc gccctggcct ccgcggtagt gggatcgctg      1320
     ctgctcaact ggttcttcac gccgcccgtc cacaccctga ccatcgccga cccgaagaac      1380
     atcgtcgcca tcgcggtctt catcggcgtc gccgtgtcgg tggcctcggt ggtggacctg      1440
     gcggcccgcc gcacccacca ggcgtcccgg ctgcgcgccg agtcggagat cctgtccttc      1500
     ctcacgggca atgtgctgcg cggtgagacc agcctggacg cgctgctgga gcgggtcagg      1560
     gagaccttcg gcatggagtc ggtcgccctg ctggagcgcc acagcgacgt ggacccctgg      1620
     acctgtgcgg gcagcgtcgg agcggacccc gcgcagtgcc cggaggacgc ggacgtcgac      1680
     gtaccggtca gcgagcacat ggcgctggcg ctctcgggcc gggtactgcc ggccgccgac      1740
     cgccgggtgc ttgccgcgtt cgccgcccag gccgcggtcg tcctggaccg gcagcggctg      1800
     cagggggagg ccgaccaggc caaggacctg gccgagggca accgcatccg caccgcactg      1860
     ctcgccgccg tcagccacga cctccgtacg ccgctggccg ggatcaaagc agccgtctcc      1920
     tctctgcgtt ccgaggacgt cgcatggtcg gaagaggacc aggcggagct gctggaggcg      1980
     atcgaggagg gcgccgaccg cctcgacctc ctggtgggca atctgctgga catgtcccgc      2040
     ctgcagaccg gcaccgtcac ccccgtcatc cgtgaggccg acctcgacga ggtggtgccg      2100
     atggcgctcg gcggcgtgcc cgagggcagc gtggagctcg acatcccgga aaccctgccc      2160
     atggtccacg tggacaaggg cctgctggag cgcgccgtcg ccaatgtcgt cgagaacgcg      2220
     gtcaagcaca gcccgcccga ccgacgagtt ctggtctccg ccagcgccat ggccgaccgc      2280
     gtcgaggtgc gggtcgtcga ccgcgggccg ggcgtgcccg acgaggcgaa ggaccgtatc      2340
     ttcgaaccct tccagcgcta cggggactcc ccgcgcggta ccggcgtcgg cttgggcctc      2400
     gccgtcgcga gagggttcgt cgaggcccag ggaggcaccc tccacgccga ggacacgccc      2460
     ggcggtggac tcacgatggt gctcagcgtg cggacggcac cggagcgccg gccggagcaa      2520
     cccagccttc cggccgcggc cacgtcctga                                       2550
//

If you have problems or comments...

PBIL Back to PBIL home page