(data stored in ACNUC7421 zone)

EMBL: CP002047.PE292

CP002047.PE292       Location/Qualifiers
FT   CDS_pept        complement(325271..325954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00292"
FT                   /product="putative two-component system response regulator"
FT                   /note="COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00292"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03413"
FT                   /db_xref="GOA:D7BWQ7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWQ7"
FT                   /protein_id="ADI03413.1"
FT                   /translation="MTRVLVVEDDPQLVRALVINLQARHYDVDAAPDGTTALRLAASHQ
FT                   PDVVVLDLGLPDMDGVDVIKALRGWTPVPVLVLSARRASEEKVAALDAGADDYMTKPFS
FT                   MDELLARLRASVRRTEAGPTAPETTLVKTDDFTVDLTAKKAHRDGRDVHLTPTEWHLLE
FT                   ILVTNPGRLVTQRHLLQEVWGASQSNKTNYLRVYMAQLRRKLEADPSHPRYLITEPGMG
FT                   YRFEE"
     atgacccggg tgctggtcgt ggaggacgac ccccaactcg tccgcgcgct cgtcatcaac        60
     ctgcaggccc gccactacga cgtcgacgcg gcgcccgacg gcaccacagc tctgcggctc       120
     gcggcctcgc accaacccga cgtggtggtc ctcgacctcg gcctgccgga catggacggt       180
     gtcgacgtca tcaaggcgct gcgcggctgg accccggtac cggttctggt gctgtccgcc       240
     aggcgggcgt ccgaggagaa ggtggcggcg ctggacgcgg gcgccgacga ctacatgacc       300
     aaaccgttca gcatggacga actgctggcc cgcctgcggg cctccgtccg ccgcaccgag       360
     gcagggccga cggcacccga gacgacgctg gtcaagacgg acgacttcac cgtcgacctg       420
     accgcgaaga aggcacaccg tgacgggcgg gacgtccatc tgaccccgac ggaatggcac       480
     ttgctggaga tcctggtgac gaaccccgga cgcctcgtca cccagcggca cctcctgcag       540
     gaggtctggg gcgcctccca gagcaacaag accaactatc tgcgcgtgta catggcccag       600
     ctgcgccgca aactggaggc cgacccctcc cacccccgct acctcatcac cgagcccggg       660
     atgggctacc gcttcgagga atga                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page