(data stored in ACNUC7421 zone)

EMBL: CP002047.PE293

CP002047.PE293       Location/Qualifiers
FT   CDS_pept        complement(326079..326747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00293"
FT                   /product="potassium-transporting ATPase subunit C"
FT                   /EC_number="3.6.3.12"
FT                   /note="COG2156 K+-transporting ATPase, c chain"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00293"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03414"
FT                   /db_xref="GOA:D7BWQ8"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWQ8"
FT                   /protein_id="ADI03414.1"
FT                   /translation="MNNSLTNTARLLGAGLRALLVLTLVTGVIYPLVITGIAQGLFSDK
FT                   ANGSEIKADGKVVGSSLIGQSYNLPLKKGQETPDPDLKWFQGRPQNGLGSNSVNTQYKL
FT                   ILSGATNRSGDNEDLIQWVNDAQTAVADVNSVPGYKVERSDVPADAVTSSGSGLDPHIS
FT                   RDYADLQVHRVAQQNKLSVSQVQKLVNDHVEGRTLGFIGEPRVNVLELNIALKAVMAKS
FT                   "
     atgaacaact ccctcacgaa cactgctcgg ttgctcggcg cgggcctgcg cgccctcctc        60
     gtgctgaccc tggtgacggg cgtcatctac ccgctggtca tcaccggcat cgcccagggc       120
     ctgttcagcg acaaggcgaa cggctccgag atcaaggcgg acgggaaggt cgtcggctcg       180
     tccctgatcg gacagtccta caacctgccg ctgaagaagg gccaggaaac gccggacccg       240
     gacctgaagt ggttccaggg ccgcccgcag aacggccttg gcagcaacag cgtcaacacc       300
     cagtacaagc tcatcctctc cggcgccacc aaccgctccg gggacaacga ggatctcatc       360
     cagtgggtga atgacgccca gaccgccgtc gccgatgtca actcggtgcc cggctacaag       420
     gtcgagcgat ccgatgtgcc cgccgacgcg gtgacgtcct ccggctcggg cctggacccg       480
     cacatctccc gtgactacgc ggacctccag gtccaccgcg tcgcgcagca gaacaaactg       540
     tccgtctccc aggtacagaa gctggtcaat gaccacgtcg aaggccgcac cctcggcttc       600
     atcggcgagc cccgggtgaa cgtcctcgag ttgaacatcg ccctcaaggc agtcatggcg       660
     aagagttga                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page