(data stored in ACNUC7421 zone)

EMBL: CP002047.PE294

CP002047.PE294       Location/Qualifiers
FT   CDS_pept        complement(326753..328885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00294"
FT                   /product="potassium-transporting ATPase subunit B"
FT                   /EC_number="3.6.3.12"
FT                   /note="COG2216 High-affinity K+ transport system, ATPase
FT                   chain B"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00294"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03415"
FT                   /db_xref="GOA:D7BWQ9"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006391"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWQ9"
FT                   /protein_id="ADI03415.1"
FT                   /translation="MTTDMKKHEEPMSTATPTRAPHSDVPTGHRPAEGRVGAGLFDPGQ
FT                   LLKSLPDAFRKLDPRVMVKSPVMFVVLVGSVLTTIFSFKDPTDWFGWAISAWLWLTVIF
FT                   ANLAEAVAEGRGKAQADTLRKAKTDTVARRLSGAAEERVPGTELKIGDLVVCEAGDIIP
FT                   GDGDVVEGVASVDESAITGESAPVIRESGGDRSAVTGGTKVLSDRIVIKITTKPGETFI
FT                   DRMINLVEGAARQKTPNEIALNILLASLTIVFLLACATLPPFAEYAHKHLTMVVLVALL
FT                   VCLIPTTIGALLSAIGIAGMDRLVQRNVLAMSGRAVEAAGDVSTLLLDKTGTITLGNRQ
FT                   ASEFVPVRGTTEAEVADAAQLSSLADETPEGRSIVVLAKEKYGLRERHQGELADAEWVA
FT                   FTAQTRMSGVDVDGRKVRKGAAGSVIAWVQQQGGTVAQDADEIANRISEAGGTPLLVAV
FT                   HDDQGARILGVIHLKDVVKEGMRERFDELRRMGIKTVMITGDNPLTAKAIAEEAGVDDF
FT                   LAEATPEDKMALIKREQAGGKLVAMTGDGTNDAPALAQADVGVAMNTGTSAAKEAGNMV
FT                   DLDSNPTKLIEIVEIGKQLLITRGALTTFSIANDVAKYFAIIPALFAAVYPGLDKLNIM
FT                   GLSSPDSAILSAVIFNALIIIALVPLALRGVQYRPVSADKMLRRNLTIYGLGGLVAPFV
FT                   GIKIIDLLISLIPGIG"
     atgaccacgg acatgaagaa acacgaggaa ccgatgtcca cagccactcc gacccgggcg        60
     ccgcacagcg acgtacccac cggccacagg cccgccgagg gccgtgtcgg cgcgggcctg       120
     ttcgaccccg gtcagctcct caagtcgctg ccggacgcct tccgcaagct cgacccgcgg       180
     gtgatggtca agtcgcccgt tatgttcgtg gtgctggtcg gctcggtcct gacgaccatc       240
     ttctccttca aggacccgac cgactggttc ggctgggcga tcagcgcctg gctgtggctg       300
     acggtgatct tcgcgaacct cgcggaggcg gtcgccgagg gccgcggcaa ggcgcaggcc       360
     gacaccctgc gcaaggcgaa gaccgatacg gtcgcgcgcc ggctcagcgg tgccgcggaa       420
     gagcgtgtgc cgggcaccga gctgaagata ggcgacctgg tcgtctgcga ggcgggcgac       480
     atcatccccg gcgacggtga cgtcgtcgag ggcgtcgcct cggtggacga gtcggccatc       540
     accggcgagt cggcacccgt cattcgcgaa tcgggcggcg accgcagcgc cgtcaccggc       600
     gggacgaagg tgctctccga ccgcatcgtc atcaagatca cgacgaagcc gggcgagact       660
     ttcatcgacc ggatgatcaa cctcgtcgag ggcgcggccc ggcagaagac gcccaacgag       720
     atcgcgctga acatcctgct cgcgtctctg acgatcgtgt tcctcctcgc gtgcgccacg       780
     ctgccgccgt tcgccgagta cgcgcataag cacctgacca tggtcgtgct ggtggccctg       840
     ctggtctgcc tgataccgac cacgatcggc gcgctgctct ccgcgatcgg catcgccggc       900
     atggaccgcc tggtccagcg caatgtgctc gccatgtccg ggcgtgccgt cgaggccgcc       960
     ggcgacgtgt ccaccctgct gctcgacaag accggcacca tcacgctcgg caaccgccag      1020
     gcgtcggagt tcgtgccggt gcgcggcacc acggaggccg aggtcgcgga cgccgcgcag      1080
     ctctcgtcgc tggccgacga gacgcccgag ggccgttcca tcgtcgtcct cgcgaaggag      1140
     aagtacgggc tgcgcgagcg gcaccagggc gagctggccg acgccgagtg ggtggccttc      1200
     accgcccaga cccgtatgtc gggcgtcgac gtcgacggca ggaaggtccg caagggcgcg      1260
     gccggttcgg tgatcgcctg ggtccagcag cagggcggta cggtcgcgca ggacgcggac      1320
     gagatcgcca accggatctc cgaggcgggc ggtacgccgc tgctggtcgc ggtccatgac      1380
     gatcagggtg cccggatcct cggcgtcatc cacctcaagg acgtcgtcaa ggagggcatg      1440
     cgggagcggt tcgacgagct gcgccgcatg ggcatcaaga ccgtcatgat cacgggtgac      1500
     aacccgctga cggccaaggc gatcgccgag gaggcggggg tcgacgactt cctcgccgag      1560
     gccacgcccg aggacaagat ggcgctcatc aagcgtgagc aggcgggcgg caaactggtc      1620
     gcgatgaccg gtgacggcac caacgacgcg cccgcgctgg cacaggcgga tgtcggcgtg      1680
     gcgatgaaca ccggtacgtc ggccgccaag gaggccggca acatggtcga cctcgactcg      1740
     aacccgacca agctcatcga gatcgtcgag atcggcaagc agctcctcat cacccggggc      1800
     gccttgacga cgttctccat cgccaacgac gtcgccaagt acttcgcgat catcccggcc      1860
     ctgttcgcgg cggtctaccc gggtctggac aagctcaaca tcatgggtct gtcctcgccc      1920
     gactccgcga tcctgtccgc ggtcatcttc aacgcgctga tcatcatcgc gttggtgccg      1980
     ctcgccctgc gcggtgtgca gtaccgcccg gtcagcgccg acaagatgct ccgccgcaac      2040
     ctcaccatct acggcctcgg cggtcttgtc gcgcccttcg tcgggatcaa gatcatcgac      2100
     ctgctcatct cgctcatccc tgggatcggg tga                                   2133
//

If you have problems or comments...

PBIL Back to PBIL home page