(data stored in ACNUC7421 zone)

EMBL: CP002047.PE296

CP002047.PE296       Location/Qualifiers
FT   CDS_pept        complement(330868..332709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00296"
FT                   /product="putative aminoacid/polyamine transporter,
FT                   permease protein"
FT                   /note="COG0531 Amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00296"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03417"
FT                   /db_xref="GOA:D7BWR1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWR1"
FT                   /protein_id="ADI03417.1"
FT                   /translation="MSVLTTEPGATPADEEPPDTGERHRLTAVTGLAALSLDAMASVAY
FT                   GPEAIVLVLAAAGAHGLGFTLPVTLAIAGLLAVLVASYRQVIAAFPDGGGSYAVARTHL
FT                   GRRTSLVAAASLVLDYVLNVAVAVTAGVAALTSAFPALYDDRLWLCLAVLVLITGVNLR
FT                   GIVESARAFIVPTVVFVCSILVLIVIGLFRSAPVSTEAAAGHVSVLADNATTVGALLLL
FT                   KAFASGCSALTGVEAIANAVPSFRVPRVKRAQLAEVALGAVLGVMLIGLSVLISRFHLQ
FT                   PVEGVTVLAQLADASLGHNWGFYVIQFATMILLALSANTSFGGLPVLLKLLARDNYLPH
FT                   VFALKADRQVHRHGVLALALVSAGLLVFSGGDTNTLVPLFAIGVFVGFTIAQVGMVRHW
FT                   RGERGARWRGKAVLNGLGAVLTGVSAVVVTATKFQEGAWLIVIALPLFVVAFETVHRAY
FT                   ARIGERLGLGRIPEPPHRDRSVVIVPVSGLSRLTCEALNAAASLGDEVRAVTVCYPDAE
FT                   DRAQTHALERAWAEWNPGVPLIPLASERRTLGRPIAAYVRETAAAEPGTRVTVLIPEVE
FT                   PERLWQRLLQNQRGAVVAHAVRRETRAVICRLRFRLS"
     atgtccgtcc tgaccacaga acccggcgcg acccccgccg acgaggagcc gccggatacc        60
     ggcgaacggc atcggctgac cgctgtcacg gggctcgccg cactgtccct ggacgcgatg       120
     gcgtcagtgg cctacgggcc cgaggcgatc gtcctggtcc tggccgccgc gggtgcgcac       180
     ggcctcggat tcacgctgcc ggtgaccctc gccatcgcgg ggctgctggc ggtgctggtc       240
     gcctcgtacc ggcaggtgat cgcggcgttc ccggacggcg gcggttcgta cgccgtggcc       300
     aggacccacc tggggcgccg tacgagtctg gtggcggccg cctcactggt cctcgactac       360
     gtgctgaacg tggccgtggc cgtcaccgcc ggtgtcgcgg cgctgacgtc ggccttcccc       420
     gcgctgtacg acgaccggct gtggctgtgc ctggccgtgc tcgtgctgat cacgggcgtg       480
     aacctgcggg ggatcgtgga gtcggcgagg gcgttcatcg tgcccaccgt ggtcttcgtc       540
     tgctcgattc tcgtcctgat cgtgatcggc ctgttccggt ccgcgccggt cagcaccgag       600
     gccgcggccg gtcatgtctc cgtgctcgcc gacaacgcca cgaccgtcgg cgccctcctc       660
     ctgctgaaag ctttcgcctc ggggtgcagc gccctgacgg gcgtcgaggc catcgcgaac       720
     gccgtcccct ccttccgggt tccgcgcgtc aagcgggccc agctggcgga ggtggctctc       780
     ggcgccgtgc tcggcgtgat gctgatcggc ctgtcggtgc tgatctcccg cttccacctc       840
     cagccggtcg agggcgttac agtcctcgcc cagctcgcgg acgcctccct cggccacaac       900
     tggggcttct atgtcatcca gttcgccacg atgatcctgc tggccctgtc cgcgaacacg       960
     tccttcggcg gcctgccggt gctgctgaag ctgctggcac gggacaatta cctgccgcat      1020
     gtgttcgccc tgaaggccga ccgacaggtc caccggcacg gtgtgctggc cctggctctg      1080
     gtctcggccg ggctgctggt cttctccggc ggcgacacca acacactcgt gccgctgttc      1140
     gcgatcggtg tcttcgtcgg cttcacgatc gcccaggtcg gcatggtgcg gcactggcgc      1200
     ggggagcgcg gcgccaggtg gcgggggaag gcggtgctga acggcctggg cgccgtgctc      1260
     accggggtct cggcggtcgt ggtcacggcg accaagttcc aggagggcgc ctggctgatc      1320
     gtgatcgccc tgccgctgtt cgtggtggcc ttcgagaccg tacaccgggc ctacgcccgg      1380
     atcggggagc ggctggggct cggccgcatc ccggagccgc cgcaccgcga ccggtccgtg      1440
     gtcatcgtgc cggtgtccgg cctgtcccgg ctgacctgcg aggcgctgaa cgcggcggcc      1500
     tccctcggcg acgaggtgcg ggcggtcacc gtgtgctatc cggacgccga ggaccgggca      1560
     cagacccacg ccctggagcg cgcctgggcc gagtggaacc ccggagtccc gctcatcccc      1620
     ctggcctccg agcgccgcac cctgggccgg cccatcgccg cgtatgtgcg ggagacggcc      1680
     gccgccgagc ccggtacccg ggtcacggtc ctcatccccg aggtggagcc ggagcggctg      1740
     tggcagcggc tgctgcagaa ccagcggggt gccgtggtgg cccacgcggt gcggcgcgag      1800
     acgcgggcgg tgatctgccg gctgcggttt cggctgtcct ga                         1842
//

If you have problems or comments...

PBIL Back to PBIL home page