(data stored in ACNUC7421 zone)

EMBL: CP002047.PE297

CP002047.PE297       Location/Qualifiers
FT   CDS_pept        complement(332977..335448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00297"
FT                   /product="Osmosensitive K channel His kinase sensor"
FT                   /note="COG2205 Osmosensitive K+ channel histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00297"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03418"
FT                   /db_xref="GOA:D7BWR2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWR2"
FT                   /protein_id="ADI03418.1"
FT                   /translation="MNDVRPGRLKVYLGAAPGVGKTYRMLDEGRRRASRGADVVVGFVE
FT                   CHGRPRTEAMLDGLEVVPRAHCDYRGGKFQEMDLAAVLARRPQVAIVDEFAHSNVPGGH
FT                   NSKRWQDVEELLAAGVDVITAVNIQHLASLNDVVEKITRVPQGETVPDEVVRRAQQIEL
FT                   VDMEPEGLRRRMAHGNIYAPEKVDAALANYFRPGNLTALRQLALLWVADQVDEALQMYR
FT                   TEHGIGRVWETRERVVVALTGGLEGDTLIRRAARIADRSAGGDLLAVHVTRSDGLAVGS
FT                   SHASLARQRRLVEDLGGSYHSVVGDDVGTALVEFARAEHATQLVLGTSRRGRIERFLGG
FT                   CGTGETVVGMSGDIDVHMVTHERAGRGMLLPSRRRTLSLVRRVAGPVAGLVLPVLLTVL
FT                   LDRARGTFNLTSEALLFLLTVVGVACIGGVASAVIASVTASLLLNYWFIPPIGAFTLDN
FT                   ADALVALGVFAIVAATVAGVVDRSLRLSRRSARATAEAETMSSLAGTIVRGGATIPALL
FT                   ERTRETFGMESADLVHHEQTPDEEGVTVVPAGPGAFLVLRGRTLPSSGRRVLAAFAAHV
FT                   GSAVERTRLAEAAAEIEPVKAADRMRTALLRAVGHDLRTPLAAGWAAVTSLRSRDVEFS
FT                   DEDRDELLATADESLAKLNRLVENLLDLSRLQAGVLTLDLRATTLEEVLPAALADIPDV
FT                   EVRDLEEIPAVMADPPLLERVIANLVGNAARHSPPGGQVALTASAHAGRVEVRVVDRGP
FT                   GLPQTGRERIFEPFQRLGDTDNTTGLGLGLALSKGLTEAMDGTLVPEDTPGGGLTMVLS
FT                   LPFAERTVYSR"
     atgaatgacg tacggcccgg acggctcaag gtctatctcg gggcggcccc cggcgtgggc        60
     aagacgtatc gcatgctcga cgagggacgc cgccgggcgt cgcgtggcgc cgacgtggtg       120
     gtcgggttcg tggagtgcca cggccggccc cgcacggagg cgatgctcga cggcctggag       180
     gtcgtgccgc gcgcccactg cgactaccgc ggcgggaagt tccaggagat ggatctcgcc       240
     gcggtgctcg cgcgccgccc tcaggtcgcg atcgtggacg agttcgcgca cagcaacgtc       300
     cccggtggcc acaactccaa gcgctggcag gacgtcgagg aactgctcgc cgcgggcgtc       360
     gacgtcatca ccgcggtcaa catccagcat ctggcatccc tcaacgatgt cgtcgagaag       420
     atcaccaggg tgccgcaggg cgagacggtc cccgacgagg tcgtccggcg ggcccagcag       480
     atcgagctgg tggacatgga gcccgagggg ctgcgccgtc gcatggcgca cggcaacatc       540
     tacgcccccg agaaggtcga cgccgctctc gccaactact tccggcccgg aaacctgacc       600
     gccctgcggc aactcgccct gctgtgggtg gccgaccagg tcgacgaggc gctgcagatg       660
     taccgcaccg agcatgggat cggcagggtg tgggagaccc gggagcgggt ggtcgtcgcg       720
     ctcaccggcg ggctcgaggg ggacaccctg atccggcggg cggcccggat cgccgatcgg       780
     tccgcgggcg gtgatctgct cgccgtgcac gtcacccgca gcgatgggct cgccgtcggc       840
     tcgtcgcacg cctcgctcgc ccggcagcgg cggctggtgg aggacctcgg cggcagctac       900
     cactcggtgg tcggtgacga cgtgggcacc gctctggtcg agttcgcccg ggccgagcac       960
     gccacccagc tggtgctggg caccagccgg cgcggacgga tcgaacggtt cctcggcggg      1020
     tgcggcaccg gcgagacggt ggtcgggatg tccggggaca tcgacgtcca catggtcacc      1080
     catgagcggg ccggacgcgg catgctgctg ccgtcccggc gcaggacgct cagcctggtc      1140
     cgccgtgtcg cgggcccggt ggccggcctg gtcctgccgg tgctgctcac cgttctcctg      1200
     gaccgggcgc gcggcacgtt caacctcacc agtgaggcgc tgctgttcct gctcacggtg      1260
     gtgggcgtgg cctgcatcgg cggggtggcc tcggcggtga tcgcgtcggt gacggcgtcc      1320
     ttgctgctga actactggtt catcccgccg atcggtgcct tcaccctcga caacgccgac      1380
     gccctggtgg cgctcggcgt gttcgcgatc gtggccgcca ccgtcgcggg cgtggtcgac      1440
     cggtccctgc ggctctcgcg acgctcggcc cgcgccaccg cggaggcgga gaccatgtcg      1500
     tccctggccg ggacgatcgt gcggggcggg gcgacgattc cggcgctgct ggagcgtacg      1560
     cgggagacct tcggcatgga gtcggcggac ctcgtccacc atgagcagac gcccgacgag      1620
     gagggcgtga ccgtcgtgcc cgcgggtccc ggtgccttcc tggtgctgcg cggccgtacc      1680
     ctcccgtcgt ccggacggcg ggtgctggcc gcgttcgccg cgcacgtcgg ctccgccgtc      1740
     gagcggaccc ggctcgccga ggccgcggcc gagatagagc cggtcaaggc cgccgaccgg      1800
     atgcgtacgg cactgctgcg ggccgtcggg cacgatctgc gcacgccgct cgccgcgggc      1860
     tgggcggccg tgacctcgct gcgcagccgg gacgtggagt tctcggacga ggaccgcgac      1920
     gaactcctcg ccaccgccga cgagtccctg gccaagctca atcggctggt ggagaacctg      1980
     ctggacctca gccgcctcca ggccggcgtc ctcaccctcg acctgcgcgc caccacgctc      2040
     gaagaggtcc tgccggcggc gctggccgac atccccgacg tcgaggtgcg ggacctggag      2100
     gagatccccg ccgtcatggc cgacccgccc ctgctggagc gcgtgatcgc caatctcgtc      2160
     ggaaacgcgg cccgccactc cccgcccggt gggcaggtcg ccctgaccgc cagcgcccac      2220
     gcgggccggg tcgaggtgcg tgtcgtcgac cgcgggcccg gcctgccgca gaccggccgg      2280
     gagcggatct tcgaaccgtt ccagcggctg ggcgacaccg acaacaccac cggactcggg      2340
     ctggggctgg ctctgtccaa gggcctgacc gaggcgatgg acggcacgct cgtaccggag      2400
     gacactcccg gcggcggcct gacgatggtg ctctccctgc cgttcgcgga gcggacggtg      2460
     tactcccggt ag                                                          2472
//

If you have problems or comments...

PBIL Back to PBIL home page