(data stored in ACNUC7421 zone)

EMBL: CP002047.PE299

CP002047.PE299       Location/Qualifiers
FT   CDS_pept        complement(336542..337480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00299"
FT                   /product="band 7 family protein"
FT                   /note="COG0330 Membrane protease subunits,
FT                   stomatin/prohibitin homologs"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00299"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03420"
FT                   /db_xref="GOA:D7BWR4"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWR4"
FT                   /protein_id="ADI03420.1"
FT                   /translation="MEGAAAIAVVVVVALLLLILRSSMRIVNQVDRGVVFRFGKALPAY
FT                   RNPGITYLVPFADRMRKVNVQVVTLPIPTQEGITRDNVSVKVDAVVYFRVTDPVRAAIE
FT                   VQDYVFAVGQVAQSSLRSIIGKSDLDDLLSDRERLHEGLAVMIDSPAAGWGVHIDRVEI
FT                   KDVQLPESLKRSMSRQAEAERERRARVITADGEFQAARQLANASRIMSDTPEAMQLRLL
FT                   QTVVEVAAEKNSTLVMPFPVELLRYFDRAARRLGDGDDNAGDNGEGTRNDTKDGTKEPR
FT                   TARTATKDGTKDGNGDPSPGPGPENSSGPAQ"
     atggagggtg cggccgccat cgcggttgtt gttgtcgtgg ctctactgct gctgatcctg        60
     cgcagcagca tgcggatcgt caatcaggtc gaccgaggcg tggtgttccg cttcgggaag       120
     gcgcttcccg cgtaccgcaa tccgggaatc acgtacctcg ttcccttcgc ggaccgcatg       180
     cgcaaggtga acgtccaggt ggtcacgctg ccgatcccga cgcaggaggg catcacacgt       240
     gacaacgtct cggtcaaggt agacgcggtg gtctacttcc gggtgacgga tccggtccgg       300
     gcggcgatcg aggtgcagga ctatgtgttc gccgtgggcc aggtcgccca gtcctcactc       360
     aggtcgatca tcggcaagag cgacctggac gatctgctgt cggaccggga acggctgcac       420
     gaggggctgg cagtgatgat cgacagccct gcggccggct ggggcgtgca tatcgaccgg       480
     gtcgagatca aggacgtaca gctgccggag tccctgaagc gctcgatgtc gcgccaggcg       540
     gaagcggagc gcgagcggcg cgcccgggtc atcaccgcgg acggcgagtt ccaggccgcc       600
     cggcagctgg cgaacgcctc ccggatcatg tccgacacac cggaagcgat gcagctgcgc       660
     ctgctgcaga ccgtggtgga ggtggccgcg gagaagaact ccacgctcgt catgccgttc       720
     ccggtggagc ttctgcggta cttcgaccgg gccgcgcgcc gtctcggaga cggcgacgac       780
     aacgccggcg acaacgggga aggcaccaga aacgacacca aggacggcac caaggaacca       840
     aggacggcaa ggacggcaac caaggacggc accaaggacg gcaacggcga cccttccccc       900
     gggccgggtc cggagaactc ctccggaccg gctcagtag                              939
//

If you have problems or comments...

PBIL Back to PBIL home page