(data stored in ACNUC7421 zone)

EMBL: CP002047.PE3

CP002047.PE3         Location/Qualifiers
FT   CDS_pept        complement(1672..2526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00003"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00003"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03124"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSU7"
FT                   /protein_id="ADI03124.1"
FT                   /translation="MKRERATMLLGEMLDRLDQGAWPLNLVEEVYLFGSYIRGALEVGD
FT                   IDVVVQHTTDERWKQESLDALFNGSDGYVTMRQALRGRRRGISFQFQERRTLEEEGFEL
FT                   LLLWRGGGGGEPVALARQRLDAITPDPAAGRAPRDHVLPPYETIADLLPRPVRIDLHRL
FT                   CADGVATVSAFPLPDAHPRSVVAAAHAEERWTSNSPLRRAATAALAHLESTGQVLDRVE
FT                   VHGQYLHQGTTDDDIDCFVDLGWRYWRRVKRYLGDGQAWFEVLPATTRKPLHALRITPA
FT                   SRA"
     atgaagcgtg agcgggcgac catgctgctg ggcgagatgc tcgaccgact ggaccaaggc        60
     gcatggccac tcaacctggt cgaggaggtc tacctgttcg ggtcctacat ccgcggcgcc       120
     ctggaagtcg gcgacatcga cgtcgtcgtg cagcacacca ccgacgagcg ctggaagcag       180
     gaatccctcg acgccctctt caacggcagc gacggctacg tgaccatgcg tcaggcattg       240
     cgaggacggc gccgcggcat cagcttccag ttccaggaac gcagaaccct cgaagaggag       300
     ggcttcgagc tgctcctgtt gtggcggggg gggggggggg gggagccggt cgccctcgcc       360
     cggcagcggt tggacgcgat cacgcccgac ccggccgccg gccgcgcgcc ccgggatcac       420
     gtcctgcctc cgtacgagac gatcgctgat ctgctcccgc gaccggtccg cattgacctg       480
     caccgcctgt gcgccgatgg cgtcgcgacg gtttcggcgt tccctctgcc cgacgcccac       540
     ccgcgctcgg tcgtagcggc ggcgcacgcg gaagagcgct ggacttcgaa cagcccgctg       600
     cgtcgtgcgg ccaccgccgc gctcgcccac ctggagagca ccggccaggt gctggaccga       660
     gtagaggtgc atggccagta cctgcaccag gggacgacgg acgacgacat cgactgcttc       720
     gtcgacctgg gctggcgcta ctggagacgc gtgaaacgtt acctgggcga cggtcaggcg       780
     tggttcgagg tcctgcccgc caccacccgg aagcccctgc acgccctgcg catcaccccc       840
     gcctcccggg catag                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page