(data stored in ACNUC7421 zone)

EMBL: CP002047.PE300

CP002047.PE300       Location/Qualifiers
FT   CDS_pept        337726..338181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00300"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03421"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWR5"
FT                   /protein_id="ADI03421.1"
FT                   /translation="MSFDDEWERAKARAMGDGPARMRLNQLVAAGGGGGGGGALVVKRD
FT                   DLGRVGHAAYELHGGLRAAGGHAKATSKAAGTDLTTDHFATGAALTKVADTWQSQVDTL
FT                   LEACARISNHLDYSTKRYGDEDATIATGLHDAHKRLLIPSRIAEYYR"
     atgtcgttcg atgatgagtg ggaacgggcc aaggctcggg cgatggggga cggcccggcc        60
     cggatgaggc tgaaccagtt ggtcgccgcg ggcggcggcg ggggcggtgg gggcgctctg       120
     gtagtcaagc gggacgactt gggaagggtg ggccacgccg cgtacgagct gcacggcggg       180
     ctgcgcgccg ccggcgggca tgcgaaggcc accagcaagg ccgcgggaac cgacctcacc       240
     acggaccact tcgcgaccgg cgccgcgctc accaaggtcg cggacacctg gcagtcgcag       300
     gtggacacgc tgctggaggc gtgtgcgcgt atctccaacc acctggacta ctccaccaag       360
     cgctacggcg acgaggacgc cacgatcgcg accgggctgc acgatgccca caagcggctg       420
     ctgatcccgt cccggatcgc cgagtactac cgatag                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page