(data stored in ACNUC7421 zone)

EMBL: CP002047.PE301

CP002047.PE301       Location/Qualifiers
FT   CDS_pept        338226..340292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00301"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03422"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWR6"
FT                   /protein_id="ADI03422.1"
FT                   /translation="MTQLTFEHVLHARLSRLNDAIDDWSAMITKLEKLAAEARNGLKAR
FT                   SDTARWEGANADVTRPFVDKTAKEFQDALTQATSIRNILRDALAAFTAAKDALRQIADH
FT                   PPTGVTIWPDGVVARSLHPDRRGKGNTDPGPSAETLDAVRERIKHAVDQATEADETVAR
FT                   ALDDILAGHPYDFGSDRYTSLDDYRRQDRERATKDADAALELAAKGSSLTDVQLARLDA
FT                   LFADNRDDPVFAERFTTGLGARGTFTFYAGITDPRQSPRPSDARIKELGEIQEHLGLVL
FT                   AQASHGDSPRMRAWKSEVIALGPQVLDLPDHQQAYGFQVMSNLMRDGVYDKRFLNDYGT
FT                   ALVKTDQAMKLPWSFWNGPLVQNNHLNFGADNDFGRDPMTGFLKALSHNPYAATEFFGA
FT                   TAPQDNSQYLLKDRPSFPDGLPESPVASRDATGAALFAAATGLYPDDKHARFVEHTADH
FT                   RQVLERSLGYLAQTGDDFPPELRDDVAKVLANHGDEVHRATSALDPESSPLDREELLEV
FT                   SKQISRNQDAYGILNEGLNQEMVRDIHAVGTGDPRETLLRAGHTVGFLEAARYLALETD
FT                   KEDPSWKAKWGYHLVGGTVGFLPAVGDIAQRGVDVVAYAWQQEEQERIHDKLSDDNNKT
FT                   FTVRERQLAALADEWAKASPRHPSADDPYILRNDIGGAAYDGNGRAKGLAGAQ"
     atgacccagc tgacgttcga gcacgtcctg cacgcgcgtc tgagcaggct caacgatgcc        60
     atcgacgact ggtcggccat gatcaccaag ctggagaagc tggccgcgga ggcccggaac       120
     gggctgaagg cccggtcgga cacggcccgt tgggaaggcg cgaacgccga tgtgaccagg       180
     ccgttcgtcg acaagaccgc caaggagttc caggacgcac tcactcaggc caccagcatc       240
     cgcaacatcc tgcgcgacgc gctggccgcc ttcaccgccg ccaaggacgc actgcggcag       300
     atcgcggacc atccccccac cggggtgacc atctggcccg acggcgtcgt cgcccgctcc       360
     ctgcaccccg accggcgcgg caagggcaac accgaccccg gcccgtccgc cgagaccctg       420
     gacgccgtac gggagcggat caaacacgcc gtcgaccagg cgaccgaggc cgacgagacg       480
     gtcgcacggg cgctcgacga catcctcgcc gggcacccgt acgacttcgg cagcgaccgc       540
     tacacctccc tcgacgacta ccggcggcag gaccgcgagc gggctaccaa ggacgccgac       600
     gccgccctcg aactggccgc caagggctcc tcactcaccg acgtacagct ggcacggctc       660
     gacgcactgt tcgcggacaa cagggacgat cctgtcttcg ccgagcgctt caccaccggc       720
     ctcggcgcca ggggcacgtt caccttctac gcgggcatca ccgacccgcg ccagtccccg       780
     cgccccagcg acgcgcgcat caaggagctc ggcgagatac aggaacacct cggcctggtc       840
     ctggcccagg cgtcgcacgg cgacagcccg cggatgcgcg cctggaagag cgaggtcatc       900
     gccctcggcc cgcaggtgct cgacctgccc gatcatcagc aggcctacgg cttccaggtc       960
     atgagcaatc tgatgcgcga cggcgtgtac gacaagcggt tcctgaacga ctacggaacc      1020
     gccctggtca agacggacca ggccatgaag ctgccgtgga gcttctggaa cgggccgctc      1080
     gtccagaaca accacctcaa cttcggcgcc gacaacgact tcggccgcga tccgatgacc      1140
     ggcttcctga aggcgctcag ccacaacccg tacgccgcca ccgagttctt cggcgccacc      1200
     gcaccacagg acaactccca gtacctcctc aaggaccgcc cctccttccc ggacggcctg      1260
     cccgagagcc ccgtcgcgag ccgggacgcc acgggcgcgg cgctcttcgc cgcggccacg      1320
     ggcctgtacc cggacgacaa gcacgcgcgc ttcgtggaac acaccgccga ccaccggcag      1380
     gtgctggagc gctcgctcgg ctatctcgca cagacgggag acgacttccc gcccgagctg      1440
     cgcgacgatg tggccaaggt cctcgccaac cacggcgacg aggtgcaccg cgccaccagc      1500
     gccctcgacc cggagtccag ccccctcgac cgcgaggagc tgctggaggt gagcaagcag      1560
     atatcccgga accaggacgc gtacggcatc ctcaacgagg gcctcaacca ggaaatggtc      1620
     cgcgacatcc acgccgtcgg caccggcgat ccacgggaga cgctgctgcg ggccgggcac      1680
     acggtcggat tcctggaagc ggcccgctat ctggccctgg agaccgacaa ggaagacccc      1740
     tcgtggaagg ccaaatgggg ctaccacctc gtcggcggaa cggtcggttt cctccccgcc      1800
     gtcggagaca tcgcccagcg cggggtcgac gtggtcgcgt acgcctggca acaggaagaa      1860
     caggaacgga tccacgacaa gctcagcgac gacaacaaca agaccttcac ggtgcgggag      1920
     cggcagctgg cggcgctcgc cgacgaatgg gccaaggcca gtccgcgcca cccgagcgcg      1980
     gacgacccct acatcctgag gaacgacatc ggcggcgcgg catacgacgg caacggccgt      2040
     gcgaagggcc tggcgggtgc ccagtga                                          2067
//

If you have problems or comments...

PBIL Back to PBIL home page