(data stored in ACNUC7421 zone)

EMBL: CP002047.PE302

CP002047.PE302       Location/Qualifiers
FT   CDS_pept        340467..341627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00302"
FT                   /product="hypothetical protein"
FT                   /note="COG3211 Predicted phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00302"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03423"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008557"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWR7"
FT                   /protein_id="ADI03423.1"
FT                   /translation="MERRIFLRGAVIGTSAAAFGGTLMRGAAYAAPAQNGPGPYGALGA
FT                   ADTNAIQLPTGFTSRVIARSGKVVSGTSYTWHNAPDGGACFADGTGWIYVSNSEVATGG
FT                   GVGAVKFDSSGTITGAHRILSNTRNNCAGGATPWQTWLSCEEVSRGYVYETDPWGVKAA
FT                   TRRDAMGQFKHEAAAADPVRKVIYLTEDETDGCFYRFTPTTWGDLSSGTLQVLVAGTAT
FT                   SGSFSWRDVPDPDGSPTATRDQVSSAKIFNGGEGCHYAGDTVWFTTKGDNRVWQLNLSN
FT                   STYELAYDDSLVNPGSAPLTGVDNVTGSSSGDLFVAEDGGNMEICIITPDDVVAPFLRI
FT                   NGQSGSEITGPAFSPDGTRLYFSSQRGTSGSSSGGITYEVTGPFRR"
     gtggaacgtc gtatcttcct gcgcggagca gtcatcggca cgtcggccgc ggccttcggc        60
     ggcacattga tgcgcggcgc cgcctacgcg gcccccgccc agaacggccc cggcccctac       120
     ggagcgctgg gcgcggccga caccaacgcc atccagctgc ccactggttt cacgagcaga       180
     gtcatcgccc gttccggaaa ggtcgtctcc ggcacctcgt acacctggca caacgccccc       240
     gacggcggcg cctgcttcgc cgacggtacg ggctggatct acgtctccaa ctcggaggtc       300
     gccactggtg gcggcgttgg cgccgtcaag ttcgactcct ccggcaccat caccggcgcc       360
     caccgcatcc tgtccaacac gcggaacaac tgcgcgggcg gcgcgacccc ctggcagacc       420
     tggctctcct gtgaagaggt cagccgcggc tacgtctacg agaccgaccc ctggggcgtg       480
     aaggccgcca cgcgccgcga cgccatgggc cagttcaagc acgaggcggc agccgccgac       540
     ccggtgcgca aggtgatcta cctgaccgag gacgagacgg acggctgctt ctaccggttc       600
     acgcccacca cctggggcga tctgtcctcc ggcacgcttc aggtgctggt cgccggcacc       660
     gccacctccg gatcgttcag ctggagagac gtacccgacc ccgacggctc tcccaccgcc       720
     acccgcgacc aggtctcgag cgccaagatc ttcaacggtg gcgagggctg ccactacgcg       780
     ggcgacaccg tctggttcac caccaagggc gacaaccgcg tctggcagct caacctgagc       840
     aacagcacct acgagctggc ctacgacgac tccttggtca accccggctc cgccccgctg       900
     accggcgtgg acaacgtcac cggctcctcc tccggtgacc tgttcgtcgc cgaggacggc       960
     ggcaacatgg agatctgcat catcacaccg gacgacgtcg tcgcgccgtt cctgcggatc      1020
     aacggccagt ccggttcgga gatcaccggc ccggccttct ccccggacgg cacccggctg      1080
     tacttctcca gccagcgcgg cacaagcggc agttcctcgg gcggcatcac ctacgaggtg      1140
     accgggccct tccgccgctg a                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page