(data stored in ACNUC7421 zone)

EMBL: CP002047.PE303

CP002047.PE303       Location/Qualifiers
FT   CDS_pept        complement(341701..343002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00303"
FT                   /product="membrane transport protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00303"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03424"
FT                   /db_xref="GOA:D7BWR8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWR8"
FT                   /protein_id="ADI03424.1"
FT                   /translation="MISLFSQVRSYERSVRLLMVNQFTINLGFYMLMPYLAAHLSGTLG
FT                   LAGWLVGLILGVRNFSQQGMFLVGGTLADRFGYKPLIIAGCVLRTAGFAALGFVDSLPA
FT                   LLAASAATGLAGALFNPAVRAYLAADAGERRVEAFALFNVFYQAGILLGPLVGMVLTGI
FT                   DFRVTCLTAAAVFAVLSVVQIRALPPRRADDARDGRDAARGSVLSQWRDVVANRPFLLF
FT                   SAAMIGSYVLSFQVYLALPLEVRRLGGQGEAGAAAVALLFAVSGLSTILGQTKVTAWCK
FT                   ARMAPGQALAWGLFTMGVAFLPLLLATAVPEPEGGAGRWLLAAVPPALSALLLALGTMI
FT                   AYPFEMDTIVRLSGDRLVATHYGLYNTICGVGITLGNLLTGAALDAARAAGMSALPWCA
FT                   LLMLGMVCAAALYGLHRTGRLAAVPAPRAQPAAA"
     gtgatatcgc tgttctcgca ggtgcgttcg tacgagcgca gcgtccggct gttgatggtg        60
     aaccagttca ccatcaacct gggcttctac atgctcatgc cctacctggc cgcccacctg       120
     tccggaaccc tcggactggc cggctggctg gtcgggctga tcctgggggt gcgcaacttc       180
     agccagcagg gcatgttcct ggtcggcggc accctggccg accggttcgg ctacaagcca       240
     ctgatcatcg ccggatgcgt gctgcgcacc gccggcttcg cggcccttgg gttcgtggac       300
     tccctgcccg cgctgctcgc cgcctcggcg gccaccgggc tcgccggagc gctgttcaac       360
     cccgccgtac gggcgtatct cgccgcggac gcgggggagc gccgggtgga ggcgttcgca       420
     ctgttcaacg tcttctacca ggccggaatc ctgctcggcc cgctggtggg catggtgctg       480
     accggcatcg acttccgcgt cacctgcctc acggccgccg cggtcttcgc cgtactcagt       540
     gtcgtccaga tccgcgcgct gccgccccgc cgggccgacg acgcccggga cggccgggac       600
     gccgcgcgcg ggagcgtgtt gtcgcagtgg cgggacgtgg tggccaaccg gcccttcctg       660
     ctcttctccg ccgccatgat cggctcgtac gtcctgtcgt tccaggtcta cctggccctg       720
     ccgctcgagg tgcgccgcct cggcggccag ggcgaggccg gggcggcggc ggtggcgctg       780
     ctgttcgccg tctcgggcct gagcaccatc ctcggacaga cgaaggtcac ggcctggtgc       840
     aaggcgcgga tggcaccggg tcaggcgctg gcttgggggc tgttcaccat gggcgtggcc       900
     ttcctgccac tgctgctggc gaccgccgtg ccggagccgg agggcggtgc gggccgctgg       960
     ttgctcgccg ccgttccgcc cgcgctctcg gcgctgttgc tcgccctggg gacgatgatc      1020
     gcctacccgt tcgagatgga caccatcgtc cggctctcgg gtgaccggct cgtcgccacc      1080
     cactacgggc tgtacaacac catctgcggg gtcggcatca ccctcggcaa cctgctcacc      1140
     ggcgccgcgc tggacgccgc tcgcgcggcc gggatgtccg cgctgccgtg gtgcgcgctg      1200
     ctgatgctgg gcatggtgtg cgctgccgcg ctgtacgggt tgcaccgcac cggccgcctt      1260
     gcggcagtgc ccgctccccg ggcacaaccc gcggcggcct ga                         1302
//

If you have problems or comments...

PBIL Back to PBIL home page