(data stored in ACNUC7421 zone)

EMBL: CP002047.PE306

CP002047.PE306       Location/Qualifiers
FT   CDS_pept        complement(344873..345334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00306"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03427"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWS1"
FT                   /protein_id="ADI03427.1"
FT                   /translation="MVTARSLSAMPRSRPSGRALRLLWVAALLFGLVYAHGVSPESVAR
FT                   HLSSATVNLGVSVGEGPAVTAPVAAEKASDSGLTVRDHRDGGHASPHPAHECLIAQPQH
FT                   GSGVVAPCQAPLGRQPAPLVAPIEAVGPAPSSSAGCPFRNSAVCAVLQI"
     atggttacgg ctcggtcgct ctccgctatg ccgcggtccc gcccctcggg gcgcgcgctg        60
     cgtctgctgt gggtggccgc gctcctgttc gggttggtgt acgcgcacgg cgtgagcccg       120
     gaaagcgtgg cgaggcacct ctcctccgcc acggtgaacc tgggtgtttc cgtaggcgag       180
     ggccctgcgg tgacggcacc ggtcgccgct gagaaggctt ctgacagcgg tcttacggtg       240
     cgggatcacc gcgacggcgg ccacgcctct ccccacccgg cacatgagtg tctgattgcc       300
     cagccacagc acggttccgg ggtggtggct ccctgccagg cgccgctcgg ccggcagccg       360
     gcgcccctag tggcgccgat cgaggcggtc ggcccggccc cgtcgtcttc ggccgggtgc       420
     ccgttcagga actccgctgt ctgcgcggtg ctgcagatct ag                          462
//

If you have problems or comments...

PBIL Back to PBIL home page