(data stored in ACNUC7421 zone)

EMBL: CP002047.PE311

CP002047.PE311       Location/Qualifiers
FT   CDS_pept        complement(350056..353535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00311"
FT                   /product="putative NRPS"
FT                   /note="COG1020 Non-ribosomal peptide synthetase modules and
FT                   related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00311"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03432"
FT                   /db_xref="GOA:D7BWS6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWS6"
FT                   /protein_id="ADI03432.1"
FT                   /translation="MHVTYRPLSVADTDGSASPIGVRIPDLRIYVLDGRGRPVPLGAVG
FT                   ELHVGGAGVARGYLNRPELTEQRFLPDPYGDRTGARMYRTGDLVRQLPDGSLEYVGRND
FT                   DQVKIRGFRIELGEIEAALAQHEAVAHGVVVPQGSADGRTLVAYLRPTRQWLDAAAQEQ
FT                   NTLLLDQWQTVFEDEYAGSHDEHDKHPADDLNLAGWESSYTGRPIPEPDMREWIDGTVH
FT                   RIHQLRPQRLLEIGCGTGLLLFRYAEACRAVHAVDLSASALADVRQGVERRGWSHITLA
FT                   QGDALSVADLPEAGFDTVVINSVAQYFPNRHYLEQALTRILPLVADGGRILIGDVRNLD
FT                   LLTPHLIAVERGHATGRTTAADLTAQVQRRRRQESELLFSPTYFTRLPARFPDLGGVDV
FT                   MVKRGVGDNEMLAYRYDVILTKSAPTATPTAAVTEPDLPWLEANTPDELRNLLEDPATP
FT                   DRFGVTGLTNPQIADDIRVSDALTRWAPTHDIAPLPHGTRLSPQAATAVRELETVLRHA
FT                   EHLGYQVAPTWSQDRPDGLDLILGKHDLPRVQARAPYRATHLANTVRIGDLGPAMARLL
FT                   KEHLTTRLPEYMVPGVFMLLEELPVTLNGKVDKRALPAPDEDAVARQEYVAPHTDTQTT
FT                   LCRILEDVLGLGRVGLEDTFFALGGHSLLAVRLNLRVRQELGRELPLQLILTGATVAEL
FT                   AAALEDEQTAADGVPLIPAVPVRDGEEAPLALQQGDLWFLNHPRHLPASYDNAQLAYRI
FT                   DGPLDRDAFVRAARALVVRHPVLRTGYVRRDGTVTQRMNDAEGFEVTVTEPIADDNALI
FT                   QWLREERTRPFAPEDPYAIRVHLVPVADEQHIFVLTRPWGVFDGWSLTIVLTELVALYR
FT                   QLSGGAEPELPGLPLAYADFARWQRQTVGTAELDRQRAYWRRQLDGLPACLSLRTDRPR
FT                   GAVKSYRGASVDFGVPLDVLTRLRQLSQEHGGSLYMTLLSAFAVLLGGHTDDREVAIGS
FT                   PVSHRPRAELEGLVGYFVNTLLIRLDIAPDRPFTELLAQARQVTAEAHDHKDLPFTELV
FT                   RDLVPEPDPAHSPLLQTMVNLVPNPAPTAGGDDAGDLRISPVDTGSRTAKHDLNLTALE
FT                   TESGLSGYLEYSTDLFADETAAHLVRSYERLLRKIAADPGADLARLRERAGD"
     gtgcacgtga cgtaccggcc gctgtcggtg gccgacaccg acggctccgc cagccccatc        60
     ggggtgcgca tccccgatct gcgtatctac gtcctggacg gccgaggccg cccggtcccc       120
     ctcggcgcgg tcggcgaact gcacgtcggt ggcgcgggtg tggcccgcgg ctatctcaac       180
     cggcccgaac tgaccgagca gcgcttcctc cccgacccgt acggcgaccg gaccggcgcc       240
     cggatgtacc ggaccggaga cctggtgcgg cagttgcccg acgggtcgct ggagtacgtc       300
     ggccgcaacg acgaccaggt caagatccgc gggttccgca tcgagctggg cgagatcgag       360
     gccgccctgg cccagcacga ggccgtcgcc cacggcgtgg tcgtcccaca agggtccgcc       420
     gacggccgca ctctggtcgc ctatctacgc cccacccggc agtggttgga cgccgcggcc       480
     caggagcaga acaccctcct gctggaccag tggcagacgg tcttcgagga cgagtacgcc       540
     ggatcccacg acgagcacga caagcacccc gccgatgacc tcaaccttgc cgggtgggag       600
     agcagctaca ccggccggcc catccccgaa cccgacatgc gcgagtggat cgacggcacc       660
     gtccaccgca tccaccaact ccgtccccag cggctgctgg agatcggctg cggcaccggg       720
     ctcctgctct tccgctacgc cgaggcatgc cgggccgtcc acgccgtgga cctgtccgcc       780
     tccgcgctgg ccgacgtacg ccagggggtc gaacgccgcg gctggtcgca tatcaccctg       840
     gcccagggcg acgccctctc ggtcgccgac ctgcccgaag ccggttttga caccgtcgtc       900
     atcaactccg tcgcccagta cttccccaac cgccactacc tcgaacaggc cctcacccgc       960
     atcctgcccc tggtggccga cggcggccgc atcctcatcg gggacgtccg caacctggac      1020
     ctgctcaccc cccatctgat cgccgtcgaa cgcggccacg ccaccggccg caccaccgcc      1080
     gccgatctga cggcccaggt ccagcgccgc cgccgacagg agagcgaact cctcttcagc      1140
     cccacctact tcacccggct tcccgcccgc ttccctgatc tgggcggcgt cgatgtgatg      1200
     gtcaaacggg gagtgggcga caacgaaatg ctcgcctacc gatacgacgt catcctcacc      1260
     aaaagcgccc ccaccgccac ccccaccgcc gccgtcacgg aaccggatct gccgtggctc      1320
     gaagccaaca cccccgacga actgcgcaac ctgctggagg accccgccac ccccgaccgg      1380
     ttcggtgtca ccggcctgac caatccgcag atcgccgacg acatccgcgt cagcgacgcc      1440
     ctcacccgct gggcacccac ccacgacatc gcccccctgc cccacggcac ccggctctcc      1500
     ccgcaggccg ccaccgccgt ccgcgagctg gaaaccgtgc tgcgccacgc cgaacacctc      1560
     ggctaccagg tcgcacccac ctggtcccag gaccgccccg acggcctgga cctcatcctc      1620
     ggcaaacacg acctcccccg cgtccaggcc cgcgccccct accgcgccac ccacctggcg      1680
     aacacggtac gtatcggtga tctgggcccg gcgatggcgc gcctgctcaa ggagcatctg      1740
     accacccggc tgccggagta catggtcccc ggggtgttca tgctgctcga agagttgccc      1800
     gtcaccctca acggaaaagt cgacaagcgc gcgctgcccg ccccggacga agacgccgtg      1860
     gccaggcagg agtacgtcgc cccgcacacc gacacccaaa ccacgctgtg ccggatcctg      1920
     gaggacgtgc tcggcctcgg ccgcgtcggg ctcgaggaca cgttcttcgc cctgggcggc      1980
     cactccctgc tggccgtgcg gctcaatctg cgggtgcggc aggagctggg ccgggaactg      2040
     ccgctccagc tgatcctcac cggcgccacc gtcgccgaac tggccgcggc gctggaggac      2100
     gagcagaccg ccgcggacgg cgtgcccctg atccccgcgg tgcccgtacg ggacggcgag      2160
     gaggcgccgc tcgccctcca acagggcgac ctgtggttcc tcaaccaccc ccggcacctg      2220
     cccgcgtcgt acgacaacgc ccagctggcg taccgtatcg acggcccgct ggaccgcgac      2280
     gcctttgtgc gcgccgcccg cgcgctcgtg gtgcgccatc ccgtcctgcg caccggctac      2340
     gtccgccgcg acggcaccgt cacccagcgg atgaacgacg ccgaggggtt cgaggtgacc      2400
     gtcaccgagc ccatcgcgga cgacaacgcc ctcattcagt ggctgcgcga ggagcggacg      2460
     cgcccgttcg caccggagga cccgtacgcg atccgtgtcc acctggtgcc ggttgccgac      2520
     gagcagcaca tcttcgtcct cacccggccc tggggcgtct tcgacggatg gtcgctgacc      2580
     atcgtgctga ccgaactggt cgcgctgtac cggcagctgt ccggcggcgc cgagcccgaa      2640
     ctgcccggcc tgccgctcgc gtacgccgat ttcgcccgct ggcagcggca gacggtcggg      2700
     accgcggaac tcgaccggca gcgcgcctac tggcggcgtc agctggacgg gctgcccgcg      2760
     tgcctgtcgc tgcgcaccga tcggccgcgg ggagcggtga agtcctaccg gggcgcctcg      2820
     gtggacttcg gtgtacccct cgacgtactc acccggctcc ggcagctgag ccaggagcac      2880
     ggcggcagcc tctatatgac gctgctgtcg gcgttcgccg tgctgctggg cggccatacg      2940
     gacgaccgcg aggtggcgat cggctcgccc gtcagccacc gtcccagggc cgaactggag      3000
     gggctggtcg gatacttcgt caacaccctg ctgatccggc tggacatcgc cccggaccgc      3060
     cccttcaccg agctgctggc acaggcccgg caggtcaccg cggaggccca tgaccacaag      3120
     gacctgccgt tcaccgaact ggtccgcgac ctggtgccgg aacccgaccc ggcgcactcc      3180
     ccgctgctcc agaccatggt caacctcgtc ccgaacccgg ctcccacggc gggcggtgac      3240
     gatgcgggcg atctgcggat ctccccggtg gacaccggct cgcggacggc gaagcacgac      3300
     ctcaacctga cggcgctgga gacggaatcc ggcctgagcg gctatctgga gtacagcacc      3360
     gacctgttcg cggacgagac cgccgcacac ctggtgcgct cctacgagcg gctgctacgc      3420
     aagatcgccg ccgaccccgg cgcggatctg gcccggctgc gcgagcgggc gggcgattga      3480
//

If you have problems or comments...

PBIL Back to PBIL home page