(data stored in ACNUC7421 zone)

EMBL: CP002047.PE312

CP002047.PE312       Location/Qualifiers
FT   CDS_pept        complement(353749..356748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00312"
FT                   /product="putative NRPS"
FT                   /note="COG1020 Non-ribosomal peptide synthetase modules and
FT                   related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00312"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03433"
FT                   /db_xref="GOA:D7BWS7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWS7"
FT                   /protein_id="ADI03433.1"
FT                   /translation="MVFGGEALDVAALDPWLRRPLNGDTQLVNMYGITETTVHVTYRPL
FT                   TPADIHGSASPIGVRIPDLRVYVLDGQGEPVPVGAVGELYVGGAGVARGYLNRPELTAQ
FT                   RFLPDRFAGQPDARMYRTGDLVRQRPDGSLEYVGRNDGQVKIRGFRIELGEIEAAVGRH
FT                   EAVRSCVVVAREDQPGGKQLVAYVVPAVKHPEQDLRAELGRHAERLLPEYMVPSAFVVL
FT                   ETLPLTTNGKLDRKALPAPGIDAYARREYVAPSTATERALAAVWAELLGFDEERVGAGD
FT                   NFFELGGHSLLITVLVARIKELGHEVSVRNVFASPTLARLAAEIDRGVAAEAYEPPPNL
FT                   IEEGCERITPDQLPLVELAQEQIDAIVATVPAGAANVSDIYPLAPAQEGILFHHLLDPD
FT                   NDPYLVSILLAADDKSACDRFTRALQALIDRHDVLRTAVRTTGLPEPVQIVQRTARLTV
FT                   ERTLLDPDHDVERQARALLDRPRALAVDQAPLLRLLIAEDPHTDRRYLLLSAHHLIEDA
FT                   TTLRLFLQELAVHMAGRTEPPPPAPYRDFVAHTLHRMASTDAETHFRAALGDVHEPTTP
FT                   FGLTNVRGDGHRYPQLRRALPAELTRQIRAQAQRLHLSPACLFHAAWACVVAAATGRDD
FT                   VVLGTVMSGRLQGVPGVERMLGNFINTLPLRVRLAGRTVRELIADVDSGLQELIAREQT
FT                   PLSLAQSSSGLGGDALFSSVVNVRHFEPGHGGPAATGLEEQGIHWLGETDAINYPLSLS
FT                   LDDFGSELSLHVRVDDAVSCEAVVDYVETALTGIVAALATHDGTRTEALAVDVLPAAER
FT                   HRVLVEWNERPGGVVSRERSVHGWFEEVVAGSRDVVAVEYEGCSLTYGELNARANRLAR
FT                   HLRGLGVGRDVLVALCLPRSERLLVCVLAVLKAGGAYVPIDPAVPVERLRYILDDSAPR
FT                   VLLVDGSVPDGLDTLDIPVVDIHADAPAWESLPDGDPDHTGGAPTDLAYVIYTSGSTGA
FT                   PKGVLVETGM"
     gtggtgttcg gcggtgaggc gctggacgtg gcggcgctcg acccgtggct gcggcgcccg        60
     ctcaacgggg acacccagct ggtcaacatg tacggcatca ccgaaaccac cgtccatgtg       120
     acgtaccggc cactgacgcc ggccgacatc cacggatcgg ccagcccgat cggggtgcgc       180
     atcccggatc tgcgggtgta tgtgctggac gggcagggcg agccggtgcc ggtcggtgcc       240
     gtgggcgagc tgtacgtggg tggcgccggt gtggcccgtg gctacctcaa ccgcccggaa       300
     ctgaccgctc agcgcttcct ccccgaccgg tttgccgggc agccggacgc ccggatgtac       360
     aggaccggcg atctggtgcg gcagcgtccc gacggctcgt tggagtatgt gggccgcaac       420
     gacggccagg tcaagatccg gggattcagg atcgagctcg gtgagatcga ggccgccgtg       480
     ggccgccatg aggcggtgcg ctcatgtgtg gtggtggccc gggaggacca gccgggcggc       540
     aagcagctgg tggcgtacgt ggtcccggcg gtcaagcacc cggagcagga tctgcgggcc       600
     gagctgggca ggcatgcgga gcggctgctg ccggagtaca tggtgcccag tgcgttcgtg       660
     gtccttgaga cgctgccgct gacgacgaac ggcaagctgg accgcaaggc gctgcccgcc       720
     cccgggatcg acgcgtatgc gcggcgggag tacgtggccc cgagcacggc caccgagcgg       780
     gcactggccg cggtgtgggc ggagctgctg gggttcgacg aggagcgtgt cggcgcgggc       840
     gacaacttct tcgagttggg cgggcattcg ctgctgatca cggtgctggt ggccaggatc       900
     aaggagctgg gccacgaggt gtcggtacga aacgtgtttg ccagcccgac gctggcccgg       960
     ctggccgcgg agatcgaccg aggcgtggcg gccgaggcat atgagccgcc gccgaacctg      1020
     atcgaggagg ggtgcgagcg catcaccccg gaccagttgc cgctggtgga gctggcccag      1080
     gagcagatcg acgccattgt ggccaccgtg cccgcaggcg cggcgaacgt atcggacatc      1140
     tatccgctgg cccccgcgca ggagggcatc ctcttccacc atctgctgga cccggacaac      1200
     gacccgtacc tggtctccat cctcctggcc gccgacgaca aatcggcgtg cgacaggttc      1260
     acccgggccc tgcaagcgct catcgaccgg cacgacgtcc tgcgcaccgc cgtgcgtacc      1320
     acagggctgc ccgagcccgt gcagatcgtg cagcgcaccg cccgcctgac cgtggagcgg      1380
     accctgctgg acccggacca tgacgtcgag cggcaggcgc gggccctgct ggaccggccg      1440
     cgggccctgg ccgtggacca ggcgccgctg ctgcgcctcc tcatcgccga ggacccgcat      1500
     acggaccgcc gctacctgct gctcagcgcg caccacctca tcgaggacgc caccacgcta      1560
     cggctgttcc tccaggagct cgcggtccac atggcgggcc ggaccgaacc gccacccccg      1620
     gccccgtacc gcgacttcgt cgcccacacc ctgcaccgga tggcgtcgac cgacgcggag      1680
     acgcacttcc gggccgccct cggcgatgtg cacgagccga ccacgccctt cgggctgacg      1740
     aacgtacggg gcgacggcca ccggtacccg cagctgcgcc gcgccctgcc cgcggagctc      1800
     acccgacaga tacgcgcgca ggcccagcgg ctgcacctca gccccgcctg cctcttccac      1860
     gccgcgtggg cgtgtgtggt ggccgcggcc accggccggg acgacgtcgt cctgggcacc      1920
     gtgatgtccg gacggctgca gggcgtgccc ggggtggagc ggatgctggg caacttcatc      1980
     aacaccctgc ccctgcgggt ccgcctcgcc ggcaggaccg tacgggagct gatcgcggac      2040
     gtcgacagcg ggctgcagga gctgatcgcc cgcgagcaga ccccgctgag cctggcccag      2100
     tccagcagcg gcttgggcgg cgacgccctg ttcagctcgg tcgtcaacgt ccgccacttc      2160
     gaaccgggcc acggcggccc ggccgcgacc ggcctggagg agcagggcat ccactggctg      2220
     ggggagaccg acgccatcaa ctacccgctg tcactgtccc tggacgactt cggcagcgaa      2280
     ctctccctgc atgtacgggt ggacgacgcc gtgtcgtgcg aagcggtcgt ggactacgtg      2340
     gagaccgcgc tgaccggtat cgtcgccgcc ctcgccaccc acgacggcac ccggaccgaa      2400
     gcgctcgccg tcgacgtcct gcccgccgcc gagcgccacc gggtcctggt cgagtggaat      2460
     gagcggccgg gtggtgtggt gtcgcgggag cggagtgttc acgggtggtt cgaggaggtg      2520
     gtggccgggt cgcgggatgt ggtggcggtg gagtacgagg gttgttcgct gacgtatggg      2580
     gagttgaacg cgcgggcgaa tcggttggcg cgccatctgc gtgggctggg tgtgggccgg      2640
     gatgtgctgg tggcgctgtg tctgccgcgt agcgagcgac tgctggtgtg tgtgctggcg      2700
     gtgctcaagg ccggtggcgc gtatgtgccc atcgacccgg ccgtccccgt ggagcggctg      2760
     cgctacatcc tcgacgacag cgcgccccgg gtgctgctgg tcgacggatc cgtccccgac      2820
     ggtcttgaca ccctcgacat cccggtggtc gacatccacg ccgacgcccc ggcatgggag      2880
     agtttgccgg acggcgaccc ggaccacacc ggcggggcac ccaccgacct cgcctatgtg      2940
     atctacacct ccggatccac gggcgcgccc aagggcgtgc tggtggagac cggaatgtga      3000
//

If you have problems or comments...

PBIL Back to PBIL home page