(data stored in ACNUC7421 zone)

EMBL: CP002047.PE316

CP002047.PE316       Location/Qualifiers
FT   CDS_pept        369886..370617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00316"
FT                   /product="hypothetical protein"
FT                   /note="COG1073 Hydrolases of the alpha/beta superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00316"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03437"
FT                   /db_xref="GOA:D7BWT1"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWT1"
FT                   /protein_id="ADI03437.1"
FT                   /translation="MRFTSETSSDGVSEQLFTLGEIPGALWTPEGVVGTRPLILLGHGG
FT                   GQHKKAPDILTLAHRLVAECGFAAVAVDVPSHGDRPQHEEYSRIAADNQARVEAGEELA
FT                   PLIARFQALVARQTVPEWRAVLDAVQQLEHVGTGPVGYWGVSLGCGLGVPFVAAEPRVR
FT                   AAVLGLGGALASAEDAARITVPVEFLVQWDDERVPRAQSLALFDALASSEKTLHANPGK
FT                   HGEVPAFERDSTLRFFSRHLI"
     atgcgcttca cctctgagac gtcgtccgac ggtgtctccg aacagctctt caccctcggc        60
     gagatacccg gcgcgctgtg gaccccggag ggtgtcgtcg gcacccgtcc cctgatcctg       120
     ctgggacacg gcggcggtca gcacaagaag gcccccgaca tcctgaccct cgcgcaccgc       180
     ttggtggccg agtgcggttt cgcggcggtg gcggtcgatg tgcccagcca cggcgaccgg       240
     ccgcagcacg aggagtacag ccggatcgcg gccgacaacc aggctcgtgt ggaggcgggg       300
     gaagagctgg ctccgctgat cgcccgcttc caggcgctcg tagcccgcca gaccgtcccg       360
     gagtggcggg ccgtcctgga cgcggtccag caactggagc acgtcggcac cgggcccgtg       420
     ggctactggg gcgtctcgct cgggtgcggg ctcggcgttc cgttcgttgc cgccgaaccc       480
     cgggtgcgtg ccgcggtgct gggtctgggt ggggccctgg cctcggccga ggacgccgcg       540
     cggatcaccg tcccggtcga gttcctggtg cagtgggacg atgaacgagt gccgcgggcg       600
     cagagcctgg cgctgttcga cgccttggcc tcttccgaga agacgctgca cgccaacccc       660
     ggcaaacacg gcgaagtccc ggccttcgaa cgggacagca cgctgcggtt cttctcccgc       720
     cacctgatct ga                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page