(data stored in ACNUC7421 zone)

EMBL: CP002047.PE317

CP002047.PE317       Location/Qualifiers
FT   CDS_pept        370768..372984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00317"
FT                   /product="serine/threonine protein kinase"
FT                   /note="COG0515 Serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00317"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03438"
FT                   /db_xref="GOA:D7BWT2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWT2"
FT                   /protein_id="ADI03438.1"
FT                   /translation="MAGMKLYSLESNDPPQLGPYRLLRRIATGGMGRIYLARQAAPGTA
FT                   AGPAGPTGTVVDHGLVAVKTLLAEGFVSKPDRERFAREVELAGRVDSAYTATVLDANAK
FT                   AERPWLAIEFIPAPSLGELVVNAGTLPADAVRWVAAAAARALVELHGRGVVHRDIKPLN
FT                   ILLPHDGPRLIDFGISHAHDHTSSTTTIGTFAFTSPEQACGKKSTAASDMYSLGATLFF
FT                   LSVGRAPYEQTDHSFGILALVQRGELDTDGLPPELEPLILPLLRVDPESRPTPSDVLRD
FT                   VLADIDQVSAEPRLPQAWTALIEEYAEQGRQLRDGAVDFAAAEAPTQVRPEGPPERADE
FT                   AISEMREQLEALRKQRDALVQAQAEEQAEAEARELARQEEEERRRREQARKEEAERRER
FT                   ERKEQERKERERKEKERKERERKERERKESQRKERERIAREKTETAAQNKSTSTTWTPK
FT                   APPKPAAAKQPAKSSGSSESWGGLLLVALIIGALVWHPWDKKDDDTPKSSPSSGVTLSS
FT                   SSGTTSGTDGGSDDDSDSGTDGYSSSSSSSSSSGGLDDTETEPEPETTSPEPEPDPTEE
FT                   AFKAVSYGDCLDVVDTGYGGTTKYDWSEEEPNTTSCGYGTRVKVTGTSGDCPSGVGKAT
FT                   WSYYSTSSGERSELCLTGQYRQGDCLLAKHEGNTISSIAMLSSPNCTDRKVPVPYNEIL
FT                   VVTNVYRATGAGAEVCRQGQYDSNTYWSTEVDDGATQLCLKAYD"
     atggccggaa tgaagctcta ttcactcgaa tccaacgatc cgccgcagct cggcccctac        60
     cggctgctgc ggcggatcgc caccggcggc atgggccgta tctatctcgc ccgacaggcg       120
     gcccccggga ccgccgccgg ccccgccgga cccaccggaa ccgtggtgga ccacggactc       180
     gtcgcggtca agacgctcct cgccgaggga ttcgtgagca agccggaccg ggagcggttc       240
     gcccgcgagg tggagctggc ggggcgggtc gacagcgcgt acaccgccac agtgctcgac       300
     gccaacgcca aggcggagcg cccgtggctc gccatcgagt tcataccggc gcccagtctg       360
     ggcgaactcg tcgtcaacgc cggtacgctg cccgccgacg cggtgcgctg ggtcgcggcc       420
     gcggccgcgc gggcgctggt cgagctgcac ggtcgggggg tcgtccaccg cgacatcaaa       480
     cccctgaaca ttctgctgcc ccacgacggc ccccgcctca tcgacttcgg tatctcgcac       540
     gcccacgacc acaccagctc gacgacgacc atcggcacct tcgcgttcac atcgccggag       600
     caggcgtgcg gcaagaagtc caccgccgcg tccgatatgt actccctggg cgccacgctc       660
     ttcttcctct cggtcggccg tgcgccgtac gagcagaccg accactcctt cggcatcctc       720
     gccctcgtcc agcgcggcga gctcgacacg gacgggctgc cgccggagct ggaaccgctg       780
     atcctcccct tgctgcgggt cgaccccgag agccgtccca ccccgtccga cgtgctacgg       840
     gacgtccttg ccgacatcga ccaagtgtcg gccgagccaa ggctgccgca ggcgtggacc       900
     gcgctgatcg aggagtacgc ggagcagggc cgccaactgc gcgacggagc ggtggacttc       960
     gccgcggccg aagcgccgac tcaggtgagg cccgagggcc ctccggagcg cgcggacgag      1020
     gcgatcagcg agatgcgtga gcagttggag gccctgcgca agcagcggga cgccttggtg      1080
     caggcgcagg ccgaggagca ggcggaggcg gaggcgcggg agctcgcgcg ccaggaagag      1140
     gaggagcgca ggcgcaggga acaggcgcgc aaggaagagg cggaacgcag ggagcgggag      1200
     cgcaaggagc aggagaggaa ggaacgggag cggaaggaga aggaacgcaa ggaacgcgag      1260
     cggaaagaac gcgagcgcaa ggagagccag cgcaaggaac gcgagcgaat agcgcgcgag      1320
     aagaccgaga ccgccgccca gaacaagagc accagcacga catggacgcc caaggctccg      1380
     cccaagcccg cagcggccaa gcagcctgcc aagagttcag gttcctcgga gagctggggt      1440
     ggcctgctcc tggtcgcgct catcatcggc gccctggtct ggcatccctg ggacaagaag      1500
     gacgacgaca ccccgaagag cagcccctcc tcgggcgtca ccctctccag cagcagcggc      1560
     accaccagcg gcaccgacgg cggttccgac gacgacagcg acagcggcac cgacggctac      1620
     agctcctcca gctcctccag ttcgtcgagc ggcggcctcg acgacaccga gaccgagccc      1680
     gaacccgaga ccacctcccc cgagcccgag cccgacccca ccgaagaggc gttcaaggcc      1740
     gtctcctacg gggactgcct ggatgtcgtc gacaccggct acggcggcac caccaagtac      1800
     gactggagcg aggaggagcc gaacacgacg tcctgcggct acgggacgcg tgtgaaggtc      1860
     accggcacca gcggcgactg cccatccggt gtgggcaagg ccacctggtc gtactactcc      1920
     accagcagcg gcgagcggag cgagctctgc ctcaccggcc agtaccgcca gggtgactgt      1980
     ctgctcgcca agcacgaggg caacaccatc agcagcatcg ccatgctgtc gtccccgaac      2040
     tgcacggacc ggaaggttcc cgtcccgtac aacgagatcc tggtcgtcac gaacgtctac      2100
     cgggcgacgg gcgccggcgc cgaggtctgc cgccagggac agtacgactc caacacgtac      2160
     tggtccacgg aggtggacga cggcgcgacg cagctgtgcc tgaaggcgta cgactga         2217
//

If you have problems or comments...

PBIL Back to PBIL home page