(data stored in ACNUC7421 zone)

EMBL: CP002047.PE318

CP002047.PE318       Location/Qualifiers
FT   CDS_pept        complement(373001..374830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00318"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="COG3573 Predicted oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00318"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03439"
FT                   /db_xref="GOA:D7BYB1"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014614"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYB1"
FT                   /protein_id="ADI03439.1"
FT                   /translation="MDNHRESSEARHGHGSEFPAGVSRRHALTVAGGVLAGAALAQMAV
FT                   PAFAAPAASADADAIVVGHGLAGLVATAELAAAGRKVLLLDQEPESNLGGQAFWSFGGL
FT                   FFVDSEEQRLMGIKDSRELAWQDWLGTAGFDRGIDDPAGQDHWAYKWAEAYVDFAAGEK
FT                   RSWLYGLGVRWFPIVGWAERGGGLADGHGNSVPRFHVTWGTGPAVVEPFEKKVRDAVAA
FT                   GKVTFKFRHRVDGIVTTGGAVTGVRGAILEPSDAARGKPTSRTVVGDFELRAPVVIVTS
FT                   GGIGANHDLVRQNWPARLGTPPKFMVTGVPAHVDGRMLAITEKAGGRIVNPDRMWHYTE
FT                   GLRNYDPIWPGHGIRILPGPSSMWFDATGKRFNTPDIPGYDTLHTLKSITDSGYDYSWF
FT                   VTTQKIIAKEFALSGSEQNPDLTEKNIWKLLSRIWQTPEPIEKFKEKGADFVVATTLPE
FT                   LVAGMNKLTGDNLIDLADLKRQIDARDREIDNPYTKDVQVMGIRNALSYPGDSLSRTAS
FT                   AHKILDSGAGPLIAVRLNILTRKTLGGLQTDLSGRVLDSTGNPIPGLYAAGEVAGFGGG
FT                   GVHGYRSLEGTFLGGCLFSGRQTGRAAAAATAS"
     atggacaacc acagagaaag ctccgaagcg cgtcacgggc acggctccga gttcccggcc        60
     ggcgtcagcc gccgccacgc cctgacggtg gcgggcggag tgctcgccgg tgccgcgctc       120
     gcccagatgg cggtcccggc cttcgccgcc cccgcggcgt cggcggacgc ggacgcgatc       180
     gtggtgggcc acgggctggc cgggctggtc gccacggccg aactggccgc ggcggggcgc       240
     aaggtgctgc tcctggacca ggagccggag agcaatctgg gcgggcaggc gttctggtcc       300
     ttcggcggtc tgttcttcgt ggactccgag gagcagcggc tcatgggcat caaggactcc       360
     cgcgaactgg cctggcagga ctggctgggc acggccggct tcgaccgcgg gatcgacgac       420
     ccggccggcc aggaccactg ggcgtacaag tgggccgagg cgtatgtgga cttcgccgcc       480
     ggagagaagc ggtcctggct gtacggcctg ggtgtgcgct ggttcccgat cgtcggctgg       540
     gccgagcgcg gcggcgggct cgcggacggc cacggcaact cggtgccccg cttccatgtc       600
     acctggggca ccggaccggc cgtcgtcgag ccgttcgaga agaaggtgcg ggacgcggtg       660
     gcggccggca aggtgacctt caagttccgg caccgcgtcg acggcatcgt gacgaccggc       720
     ggggcggtca ccggcgtacg cggcgccatc ctggaaccga gcgacgccgc acgcggcaag       780
     cccacctccc gtaccgtggt cggcgacttc gaactccgcg cccctgtcgt gatcgtcacc       840
     tcaggtggca tcggcgccaa ccatgacctc gtacggcaga actggccggc ccgcctcggc       900
     accccgccga agttcatggt caccggcgtg cccgcgcatg tggacggccg catgctcgcg       960
     atcaccgaga aggcgggcgg gcggatcgtc aacccggacc gtatgtggca ctacaccgag      1020
     ggcctgagga actacgaccc gatctggccc ggccatggca tccgtatcct gcccggcccc      1080
     tcgtccatgt ggttcgacgc caccggcaaa cgcttcaaca cgcccgacat ccccggctac      1140
     gacaccctgc acaccctcaa gtcgatcacc gactccggct atgactactc ctggttcgtc      1200
     accacccaga agatcatcgc caaggagttc gcgctctccg gctccgagca gaacccggac      1260
     ctcaccgaga agaacatctg gaagctgctg tcgcggatct ggcagacgcc ggagccgatc      1320
     gagaagttca aggagaaggg ggccgacttc gtcgtcgcca ccacgctgcc cgaactcgtc      1380
     gcgggcatga acaaactcac cggcgacaac ctcatcgacc tcgccgacct caaacggcag      1440
     atcgacgccc gagaccggga gatcgacaac ccgtacacca aggacgtcca ggtcatgggc      1500
     atccgcaacg ccctcagcta ccccggggac tcgctcagcc gcaccgcctc ggcgcacaag      1560
     atcctggatt ccggcgccgg ccctctcatc gccgtgcgcc tcaacatcct cacccgcaaa      1620
     accctcggcg gcctgcagac cgacctctcc ggccgcgtcc tggacagcac cggaaacccc      1680
     atacccggtc tgtacgcggc cggagaagtc gcgggattcg gcggcggcgg cgtccacggc      1740
     taccgctccc tggagggcac cttcctgggt ggctgtctgt tctccggccg ccagacgggc      1800
     cgcgcggccg cggccgccac cgcgtcctga                                       1830
//

If you have problems or comments...

PBIL Back to PBIL home page