(data stored in ACNUC7421 zone)

EMBL: CP002047.PE322

CP002047.PE322       Location/Qualifiers
FT   CDS_pept        complement(385564..386403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00322"
FT                   /product="hypothetical protein"
FT                   /note="COG0702 Predicted nucleoside-diphosphate-sugar
FT                   epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00322"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03443"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYB5"
FT                   /protein_id="ADI03443.1"
FT                   /translation="MIAVTGATGNIGRPLTQALAEAGQQVTAVSRHTAAVPNGVRHVAA
FT                   DLAEPAGLKPALAGAKALFLLLSGDLHATGASPADIISEAAVSGVRRVVLLSTLGVVTR
FT                   PFGPTRIAMRALEDMLRESGLEWAVLRPGGFASNALWWAESVRAQQVVAAPFGDVGVPI
FT                   IDPADIAAVAAACLLDDRHTGGVYELTGPEVITPRQQSEAIAAALGSPVRFHELTRDEA
FT                   KAAMAQSMPAELADDTLDILGSPSPAELRISPDVQRVLGRAPRPFADWAARNVAAFR"
     atgatcgcgg tgaccggggc taccggaaat atcggccggc cgttgacgca ggcgctggcc        60
     gaggcgggcc agcaggtgac ggcggtgtca cggcacacgg cggcggtgcc gaacggcgtc       120
     cgtcatgtgg cggccgacct ggccgagccg gccggcctca agcccgcgct ggccggggcg       180
     aaggcgctgt tcctgctgct gtccggcgac ctgcacgcca ctggagccag ccctgccgac       240
     atcatcagcg aagctgcggt cagcggggtc cgccgggtcg tcctgctctc cacgctgggc       300
     gtggtgacca ggcccttcgg ccccacgcgg atcgcgatgc gcgcgctgga ggacatgctg       360
     cgggagtccg gcctggagtg ggccgtcctg cggccgggcg gcttcgcctc caacgccctg       420
     tggtgggccg agtccgtccg cgcgcaacag gtcgtcgccg cgcccttcgg cgacgtcggg       480
     gtgccgatca tcgacccggc ggacatcgcc gcggtcgcgg cggcctgcct gctggatgac       540
     cggcacaccg gcggcgtgta cgagctgacc ggcccggagg tgatcactcc gcgccagcag       600
     tcggaggcca tcgccgccgc gctgggctcg ccagtgaggt ttcacgagct cacccgcgac       660
     gaggccaagg ccgccatggc ccagagcatg ccggcggagc tcgccgacga cactctggac       720
     atcctcggtt ccccgagccc ggccgagctg cgcatcagcc cggacgtcca gcgggtcctc       780
     ggccgcgccc cgcgcccctt cgccgactgg gccgcccgca atgtcgccgc gttccgctga       840
//

If you have problems or comments...

PBIL Back to PBIL home page