(data stored in ACNUC7421 zone)

EMBL: CP002047.PE323

CP002047.PE323       Location/Qualifiers
FT   CDS_pept        386496..386861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00323"
FT                   /product="hypothetical protein"
FT                   /note="COG1733 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00323"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03444"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYB6"
FT                   /protein_id="ADI03444.1"
FT                   /translation="MAGGVQRRQAEAGARYDVFHTDCAARDVVDHVTSRWGVWVLISLR
FT                   SNDLRFYELRESIQGISEKMLAQTLRALVQDGLVWREVEPTTPPQVTYGLTEFGRDVGE
FT                   PLTELFDRITRRLPPRP"
     atggcgggag gcgtgcagcg cagacaggcc gaggcggggg cgcggtatga cgtgtttcac        60
     accgactgcg ccgcgcgcga tgtggtcgac cacgtgacca gcaggtgggg cgtctgggtg       120
     ctgatctcct tgcggagcaa cgacctccgg ttctacgagc tgcgcgagag catccagggc       180
     atcagcgaga agatgctcgc ccagaccctg cgcgcactgg tccaggacgg cctggtctgg       240
     cgggaggtcg agccgacgac gccgccccag gtcacctacg ggctgaccga gttcggccgg       300
     gacgtgggcg agccactgac ggagctgttc gaccggatca cacggcggct gccaccacgg       360
     ccgtga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page