(data stored in ACNUC7421 zone)

EMBL: CP002047.PE324

CP002047.PE324       Location/Qualifiers
FT   CDS_pept        387147..387581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00324"
FT                   /product="hypothetical protein"
FT                   /note="COG1917 Uncharacterized conserved protein, contains
FT                   double-stranded beta-helix domain"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00324"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03445"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYB7"
FT                   /protein_id="ADI03445.1"
FT                   /translation="MDSVGETGKQPRSEAWKTAAQMLQDAKPPFLPEGASGMTISVEWL
FT                   PGDPGTPPHRHSGPAFGYVIEGAVRFELEGEPERVIKAGETFWEPGGDVIHYQDGNALT
FT                   DSKTRFIVTMLCAPGQPMLTLVDEEELAQRAHLRAPRPVD"
     atggactcag tgggcgagac cggcaagcag ccacggtccg aggcgtggaa gacggcagcg        60
     cagatgctgc aggatgccaa gcctcccttc ctccccgagg gcgcctcggg gatgaccatc       120
     tcggtcgaat ggcttcccgg ggatcccgga acccctccgc atcgtcactc ggggccggcc       180
     ttcggatacg tgatcgaggg cgcggtgcgc ttcgagctcg agggcgagcc ggaacgcgtg       240
     atcaaggccg gagagacatt ctgggagccg ggtggcgatg tgatccatta ccaggacggc       300
     aacgccctga cggactccaa gacgcgtttc atcgtgacca tgctgtgtgc gccgggccag       360
     ccgatgctca cgctggtcga cgaggaggaa ctggcccagc gggcccatct gcgcgccccg       420
     cgccccgtgg actga                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page