(data stored in ACNUC7421 zone)

EMBL: CP002047.PE325

CP002047.PE325       Location/Qualifiers
FT   CDS_pept        complement(387694..388167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00325"
FT                   /product="hypothetical protein"
FT                   /note="COG2128 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00325"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03446"
FT                   /db_xref="GOA:D7BYB8"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYB8"
FT                   /protein_id="ADI03446.1"
FT                   /translation="MESRLNYFGNPLAGKVLKHINSAGKAVSDSTLPAATQELVKIRAS
FT                   QINGCGFCTDMHTKDAALAGETSLRLNLIAAWREATVFTDAERAALELAEQGTRIADAA
FT                   GGVTDEAWANAAKHHDEEQLVALISLIAVINAYNRINVINQQPAGGYKPGQFG"
     atggaatcgc gtctcaacta cttcggcaat cccctcgcgg gcaaggtgct gaagcacatc        60
     aactcggccg gcaaggcggt gtccgactcg acgttgccgg ccgcgacgca ggagctggtg       120
     aagatccgcg caagccagat caacggctgc ggcttctgca ccgacatgca cactaaagat       180
     gccgccctcg ccggggaaac ctcgctgcgc ctcaacctga tcgcggcctg gcgcgaggcc       240
     acggtcttca ccgacgccga gcgcgccgcg ctggagctgg cggagcaggg cacccgtatc       300
     gccgacgcgg ccggtggtgt cacggacgag gcgtgggcca acgctgccaa gcaccacgac       360
     gaggagcagc ttgtcgccct gatttccctc atcgccgtca tcaacgccta caaccgcatc       420
     aacgtcatca accagcagcc cgccgggggc tacaagcccg gccagttcgg ctga             474
//

If you have problems or comments...

PBIL Back to PBIL home page