(data stored in ACNUC7421 zone)

EMBL: CP002047.PE326

CP002047.PE326       Location/Qualifiers
FT   CDS_pept        388713..389039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00326"
FT                   /product="hydroperoxide resistance protein"
FT                   /note="COG1764 Predicted redox protein, regulator of
FT                   disulfide bond formation"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00326"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03447"
FT                   /db_xref="GOA:D7BYB9"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYB9"
FT                   /protein_id="ADI03447.1"
FT                   /translation="MPAELGGDGQGTNPEQLFAAGFAACFHGALSLVARQAALDPSTIS
FT                   VDATVAFGRDPEDGGYLLHVDLVVSWPGTDPEIAAPLLEKADSLCPYARMAWQGTPTTI
FT                   TLAS"
     atgcccgccg aactgggggg agacggccag gggacgaatc cggagcagtt gttcgccgcc        60
     ggtttcgcgg cctgcttcca cggagcgctg agcctggtgg cacggcaggc cgcgctcgac       120
     ccctccacga tctccgtaga cgcgaccgtg gcctttgggc gggacccgga agacggcggc       180
     tatctgctgc acgtcgatct ggtggtctca tggccgggca ccgatccgga gatcgccgct       240
     cccctgctgg agaaggccga ctcgctgtgc ccctacgcca ggatggcctg gcagggaacg       300
     ccgaccacca tcacgctggc ttcctag                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page