(data stored in ACNUC7421 zone)

EMBL: CP002047.PE330

CP002047.PE330       Location/Qualifiers
FT   CDS_pept        392942..393676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00330"
FT                   /product="hypothetical protein"
FT                   /note="COG0702 Predicted nucleoside-diphosphate-sugar
FT                   epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00330"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03451"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYC3"
FT                   /protein_id="ADI03451.1"
FT                   /translation="MIGGTGLIGSKLVGKLTEHGHEAVAAAPNTGVNTLTGEGLAEVLE
FT                   GASVVVDVSNSPSFEDEAVMDFFRTSTTNLLKAEAEAGVTHHVALSVVGTERLQESGYF
FT                   RAKQAQEELIKDSGIPYSIVHATQFFEFAKGLADGVTDGDTVRLPAGKIQPIVSDDVAA
FT                   AVGRTAVGPPVNGVVEVAGPEAFELEDFIRMGLAAKNDPRKIVTDPKATYWGAELQETT
FT                   LLPGPDAHIAETKFADWLAQQQ"
     gtgatcggtg gtaccgggct catcggctcg aagctggtcg gcaagctcac cgagcacggg        60
     cacgaggcgg tcgcggccgc gcccaacacc ggcgtcaaca cgctgacggg cgagggcctg       120
     gccgaggtcc tggagggcgc gtcggtcgtg gtcgacgtgt ccaactcccc ctcgttcgag       180
     gacgaggccg tgatggactt cttccgcacc tcgaccacca acctgctgaa ggcggaggcc       240
     gaggccggtg tgacacacca tgtggcgctg tccgtggtcg gcaccgaacg gctgcaggag       300
     agcgggtact tccgcgccaa gcaggcccag gaggagctga tcaaggactc gggcatcccg       360
     tactccatcg tccacgccac ccagttcttc gagttcgcga aggggctcgc cgacggggtc       420
     accgacggcg acaccgtgcg tctgcccgcc gggaagatcc agcccatcgt ctccgacgac       480
     gtggccgcgg ccgtcggccg caccgcggtc ggtcccccgg tcaacggtgt ggtggaggtc       540
     gcgggccctg aggccttcga gctcgaggac ttcatccgca tgggactcgc cgcgaagaac       600
     gacccccgca agatcgtcac tgacccgaag gccacgtact ggggtgccga gctgcaggag       660
     accacgctcc tgcccggccc tgacgcgcac atcgccgaga ccaagttcgc cgactggctc       720
     gcgcagcagc agtga                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page