(data stored in ACNUC7421 zone)

EMBL: CP002047.PE331

CP002047.PE331       Location/Qualifiers
FT   CDS_pept        393585..394850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00331"
FT                   /product="putative transmembrane efflux protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00331"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03452"
FT                   /db_xref="GOA:D7BYC4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYC4"
FT                   /protein_id="ADI03452.1"
FT                   /translation="MPSCRRPRSCPALTRTSPRPSSPTGSRSSSEPCQWPSRPRAVPRS
FT                   GNGAGRRHSVRRHCDSHRLSVHTVSAGVASLLCGLAPNMGMLITARALQGVGGALLTPG
FT                   SLALIEASFHPDDRARAVGLWSGFGGIGAAVGPFLGGWLVDGPGWRWIFLLNVPLALAC
FT                   VSIALRHVPESMAAPHQAAAVDSGTGAVPEDTARRQHGFDVSGAALGALALALATYALV
FT                   EARNGSLVVALSAAGGVAAGFAFVFVERHRPDPMMPLSRGSTADRGGDAHDAPGRPRRV
FT                   VCRRCSPCPAGHRRRHGQLRRSADGDPAGLGGQWKSRTRKRDQQRGRAGRRARRRCGAA
FT                   AAHRHGLGRVSLGRGIQRVISPGDADMRGDSGGRGGVGLRHGARRGPGPSSASMPEAWV
FT                   VDDAAPGATAQPPPAMSSASPL"
     gtgccgagct gcaggagacc acgctcctgc ccggccctga cgcgcacatc gccgagacca        60
     agttcgccga ctggctcgcg cagcagcagt gagccctgcc agtggccgtc tcgcccccgc       120
     gccgttccac gcagtgggaa cggcgcgggg cgacgccact ccgtacgcag acactgtgat       180
     tcacaccgac tcagtgtgca caccgtgtct gccggcgtgg cctcgctcct gtgcggcctc       240
     gctcccaaca tgggcatgct catcaccgct cgcgccctgc agggcgtcgg tggcgcgctt       300
     ctcaccccgg gctcgctcgc acttatcgag gcatcgttcc acccggatga ccgggcccgc       360
     gcggtcggcc tgtggtcggg attcggcggc atcggcgcgg cagtcggccc gttcctgggc       420
     ggctggctgg tggatggccc tggttggcgc tggatcttcc tgctgaatgt accgctggct       480
     ctggcatgtg tgtccatcgc gctgcgccac gtaccggaat ccatggccgc tccccatcag       540
     gctgccgcgg tggactccgg aaccggggcg gtaccggagg acaccgcgcg ccgacagcat       600
     ggcttcgacg tttcaggggc cgcccttggg gcgcttgcgc tcgctctggc gacatacgcg       660
     ctggtcgagg cccggaatgg aagcctcgtg gtggccctct cggcggccgg cggcgtggcg       720
     gcgggcttcg cgtttgtgtt cgtagaacgg catcggcctg accccatgat gccgctgtcc       780
     cgtgggtcca ctgctgaccg cggcggggat gctcatgatg ctccgggtcg acctcggcgc       840
     gtcgtatgtc ggcgatgttc tccctgccct gctggtcata ggcgccggca tggtcagctt       900
     cgtcgctccg ctgacggtga ccctgctggc ctcggtggac agtggaaaag ccggactcgc       960
     aagcgggatc aacaacgcgg ccgcgcgggc cgccgggctc gtcgccgttg cggcgctgcc      1020
     gctgctcacc ggcatggact cggacgcgta tcgctcgggc gaggcattca acgagtcatt      1080
     tcgccgggcg atgccgatat gcgcggcgat tctggaggtc ggggcggtgt tggccttcgt      1140
     cacggtgcga ggcgcggccc cggaccgtca tcggcctcaa tgccggaggc atgggtggtt      1200
     gacgacgccg cccctggagc cacggcccag ccaccgcccg cgatgagtag cgcaagtccg      1260
     ctatga                                                                 1266
//

If you have problems or comments...

PBIL Back to PBIL home page