(data stored in ACNUC7421 zone)

EMBL: CP002047.PE332

CP002047.PE332       Location/Qualifiers
FT   CDS_pept        394892..395635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00332"
FT                   /product="hypothetical protein"
FT                   /note="COG2120 Uncharacterized proteins, LmbE homologs"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00332"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03453"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYC5"
FT                   /protein_id="ADI03453.1"
FT                   /translation="MTESNSTQLQPMPTDWQRALAVVAHPDDLEYGCSAAMASWIDEGR
FT                   EIAYVLATRGEAGIDTVAPAECGPLREREQRASAAAVGVSVVEFLDHRDGTIEYGVSLR
FT                   RDIAAAIRRHRPELVITLNHHTTWDGGVWNTPDHVAVGHATLDAAADAGNRWIFPELTE
FT                   QGLQPWNGVRWVAVANSKNPTHAVPAEPGLERAVRSLLEHRAYIEALTDEDPETYVRRF
FT                   LTENTRELSARFGGQPAVVFELFNR"
     atgacggagt cgaactctac gcagctgcag cccatgccca cggactggca gcgtgccctc        60
     gccgtggtgg cccaccctga tgaccttgaa tacgggtgtt cggccgccat ggcttcctgg       120
     atcgacgagg gccgcgagat cgcctatgtc ctcgccacgc gtggcgaagc aggcatcgac       180
     accgtcgcac cggctgagtg cggaccgttg cgggagcgtg agcagcgggc cagtgccgcc       240
     gccgtcggcg tgtccgtggt ggagtttctc gaccaccggg acggcacgat cgagtacggc       300
     gtctccctgc gtcgtgacat tgccgctgcc atccgtcgcc accggcccga gctggtgatc       360
     accctcaacc atcacaccac atgggatggg ggcgtctgga acaccccgga ccacgtggcc       420
     gtggggcacg ccacgctcga cgcggcggcg gacgccggca accgctggat ctttccggag       480
     ctgaccgagc agggcttgca accatggaat ggtgtccgct gggtcgccgt cgccaactcc       540
     aagaacccca cccacgccgt accggcggag cccggtctgg agcgggcggt gcgctcgctg       600
     ctcgagcacc gcgcctacat cgaggcgttg acggacgagg atcccgagac ctatgtgcgt       660
     cgtttcctga ccgagaacac ccgcgagctg agcgcacggt tcggcgggca accagccgtt       720
     gtcttcgagc tgttcaaccg atga                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page