(data stored in ACNUC7421 zone)

EMBL: CP002047.PE334

CP002047.PE334       Location/Qualifiers
FT   CDS_pept        complement(396785..397258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00334"
FT                   /product="hypothetical protein"
FT                   /note="COG2128 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00334"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03455"
FT                   /db_xref="GOA:D7BYC7"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYC7"
FT                   /protein_id="ADI03455.1"
FT                   /translation="MDARLNYFTIPAAGKALKYFMSAGKELKDMPLPAATQELVALRVS
FT                   QINGCAVCIDMHTKEATAAGETPVRLNLVAAWREATVFTEAERAALALAEEGTRVADAA
FT                   HGVSDETWAQAATHYDQEQLTALVILVSFMNSVNRLNIITQQPAGNYQAGQFH"
     atggacgcgc gactgaacta cttcaccatc cctgccgctg ggaaggctct caagtacttc        60
     atgtcggcgg gcaaggagct caaggacatg ccactgcccg ccgcgacgca ggaactggtg       120
     gccctgcgcg tgagccagat caacggctgc gccgtctgca tcgacatgca caccaaggaa       180
     gccaccgccg cgggcgagac cccggtacgg ctcaacctgg tcgcggcatg gcgggaggcc       240
     accgtcttta ccgaggccga acgcgccgca ctggcactgg cagaggaagg cacccgcgtc       300
     gccgacgcgg cccacggggt cagcgatgag acatgggcgc aagccgccac ccactacgac       360
     caggaacagc tcaccgccct ggtcatcctg gtctccttca tgaactcggt gaaccggctc       420
     aacatcatca cccagcagcc cgccggcaac taccaggccg gacagtttca ctga             474
//

If you have problems or comments...

PBIL Back to PBIL home page