(data stored in ACNUC7421 zone)

EMBL: CP002047.PE335

CP002047.PE335       Location/Qualifiers
FT   CDS_pept        complement(397383..399056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00335"
FT                   /product="cytochrome B subunit"
FT                   /note="COG1290 Cytochrome b subunit of the bc complex"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00335"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03456"
FT                   /db_xref="GOA:D7BYC8"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYC8"
FT                   /protein_id="ADI03456.1"
FT                   /translation="MDNCALEPAAQEIAEATANAGRSTEPQRGRRGEKVAEWTRGRLGV
FT                   RNLTRAGMRKAFPDHWSFMLGEICLYSFLIVIATGIYLSLYFHPTMNQVEYRGSYLPLR
FT                   GQMVSEAFDSTMHISFDVRGGLLIRQAHHWAALIFVAGIFVHMMRVFFTGAFRRPRELN
FT                   WVFGFLLLLLAMFAGLTGYDLPGDLLSGTGLVVVNGTLLSVPIVGTYLSMFLFGGEFPG
FT                   NDLVARFNAIHVLVIPGLMVGLIVAHLILVFRHKHTQYPGPGRTNRNVIGMPLRVHAVK
FT                   AAGYFFLVTGVIFVIASIAQINPIWEYGPYRPDQVSAGSQPDWYMGVADGLIRVMPGWE
FT                   ISIWGHTLALDNLIPLLAGVGLFLVMGAYPFIEAWVTDDDREHHLLDRPRNRPVRTGLG
FT                   AAWISVYLVALTGAGNDIIATQFHVSVNSVTWAVRIGLFLVPIAVYAVTKRWALGLQRR
FT                   DRDKVLHGRETGIIKRLPHGEFVEVHEPLSRERLHILTAHEQYQPIESGGPGVQGGPVR
FT                   STSRTRRLRARLSRGFYGEGTQIPKPTVQEYEEITSGHRR"
     atggacaact gtgctctcga gcctgcggct caggagatcg cggaggcgac ggccaacgcg        60
     ggccggtcaa ccgaaccgca gcgagggcgc agaggggaaa aggttgccga atggacccgc       120
     gggcggctgg gcgtccgcaa tctcaccaga gccggtatgc gaaaggcatt cccggaccac       180
     tggtccttca tgctggggga gatctgcctc tacagcttcc tcatcgttat cgccacgggc       240
     atctatctga gcctgtactt ccacccgacg atgaaccagg tcgaataccg tggcagctac       300
     ctgcccctgc ggggccagat ggtgtccgaa gcatttgatt caaccatgca catctccttc       360
     gatgtgcgcg gcggcctgct gatccggcag gcccaccact gggcggcgct gatattcgtc       420
     gccggaatat tcgtgcatat gatgcgcgtg ttcttcacgg gcgcgtttcg caggccgcgc       480
     gagctcaact gggtgttcgg ctttctgctg ctgctcctgg ccatgttcgc cggtttgacg       540
     ggatacgacc tcccgggcga tctgctgtcc gggaccggac tggtggtcgt gaacggaaca       600
     ctcctttccg tgccgatcgt cggcacttat ctgtcgatgt tcctcttcgg gggtgagttc       660
     cccgggaacg acctggtggc gcgattcaac gccattcacg ttctggtgat ccccggcctc       720
     atggtggggc tgatcgtcgc ccatctgatc cttgtgttcc gccacaagca cacccagtac       780
     ccggggccgg ggcgcaccaa caggaacgtc atcggcatgc cgctccgggt gcacgcggta       840
     aaagctgcag ggtatttttt cctggtcacc ggggtaatct tcgtcatcgc ttcgatcgca       900
     cagatcaatc ccatctggga gtacggcccc taccgccccg atcaggtttc ggcgggatca       960
     cagccggact ggtacatggg cgtagccgac gggctgattc gggtcatgcc cggctgggag      1020
     atcagtatct ggggccatac cctggccctt gacaacctga tcccgctgtt ggccggcgtc      1080
     ggtctgtttc tcgtcatggg tgcgtacccg tttatcgagg catgggtcac cgatgacgac      1140
     cgtgaacacc atctcctcga cagaccacgc aaccggccgg tgcgcacggg gctcggcgcg      1200
     gcatggatca gtgtctatct ggtggcgctg accggcgccg ggaacgacat catcgcgacc      1260
     cagttccatg tctcggtcaa ttccgtgacg tgggcagttc gcatcggcct cttcctcgta      1320
     cccatcgctg tctatgcggt gacgaagcgg tgggccctcg gcctccagcg tcgcgaccgg      1380
     gacaaggtgc tgcacggacg tgagaccggc atcatcaagc gcttgccgca cggggagttc      1440
     gtcgaggtgc atgagccact gagccgggag cgactgcaca tcctgacagc gcacgagcag      1500
     taccagccca tcgagtccgg tggcccgggt gttcaaggag gcccggtgag gagtaccagc      1560
     cgcactcgac ggttgcgggc caggctcagc cggggcttct acggggaggg gacgcagatt      1620
     cccaagccca ccgtccagga gtacgaggag atcaccagcg gccatcgacg gtga            1674
//

If you have problems or comments...

PBIL Back to PBIL home page