(data stored in ACNUC7421 zone)

EMBL: CP002047.PE339

CP002047.PE339       Location/Qualifiers
FT   CDS_pept        401838..402176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00339"
FT                   /product="hypothetical protein"
FT                   /note="COG1917 Uncharacterized conserved protein, contains
FT                   double-stranded beta-helix domain"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00339"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03460"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYD2"
FT                   /protein_id="ADI03460.1"
FT                   /translation="MTGKVIAQSTVAGRDYILREVTIPPGQATGWHFHDGTLYAYVKQG
FT                   TLSHFAATCKSDGVHPQGRFLEEPPGADHVHIGRNLGATDVVLEVLYVLPHGAPFSQDA
FT                   PNPGCDFQ"
     gtgaccggca aggtcatcgc ccagtccacc gtggccgggc gcgactacat cctgcgggaa        60
     gtcaccatcc cgccgggtca ggcaaccggt tggcacttcc acgacggcac cctctacgcg       120
     tatgtcaagc agggcaccct gagccacttc gctgccacct gcaagtccga cggtgtgcac       180
     ccccagggcc gtttcctcga ggaaccgccc ggcgccgacc acgtacacat cggccgaaac       240
     ctcggtgcca cggacgtcgt cctggaagtt ctctacgtcc tcccgcacgg cgcccccttc       300
     tcccaggacg cccccaaccc gggctgcgac ttccagtag                              339
//

If you have problems or comments...

PBIL Back to PBIL home page