(data stored in ACNUC7421 zone)

EMBL: CP002047.PE34

CP002047.PE34        Location/Qualifiers
FT   CDS_pept        complement(32875..33417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00034"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03155"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSX8"
FT                   /protein_id="ADI03155.1"
FT                   /translation="MDDKIWFIGLPYDDDRDASAPADQQCLAEVLEGQGFRTAPADFGP
FT                   SLEVWLPDPSEFAASVHLGDSWMVQIAVDERRLAEDFDEYRGNTDALAKLIGIVTEYAG
FT                   TYLGFVTADDDDDLSFMEEDPPVHLGQPLAMVYFGRRYLSGWPDEPQWAADPKARWELP
FT                   TGVLLVPASSPLEITRA"
     atggacgaca agatctggtt catcggtctg ccctacgacg acgatcgtga cgcgtctgcc        60
     ccagccgacc agcagtgtct cgccgaggtc ctggaggggc agggcttccg gacggcgccc       120
     gccgacttcg ggccgtcgct ggaggtgtgg ctgccggacc cgtcggagtt cgcggcctcg       180
     gtccacctcg gtgacagctg gatggtgcag atcgccgtcg acgagcgccg gctcgccgag       240
     gacttcgacg agtaccgggg caacaccgac gccctggcga agctgatcgg catcgtcacc       300
     gagtacgcgg gcacgtacct cgggttcgtc accgccgacg acgatgacga tctgtccttc       360
     atggaggagg atccgccggt ccatctggga cagccgctcg cgatggtcta tttcggacgg       420
     cgttacctga gcggctggcc ggacgagccg cagtgggccg cggacccgaa ggcacgctgg       480
     gagctgccga ccggagtcct gctggttccg gcatcctccc cgctcgagat cacccgggct       540
     tag                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page