(data stored in ACNUC7421 zone)

EMBL: CP002047.PE342

CP002047.PE342       Location/Qualifiers
FT   CDS_pept        404107..404571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00342"
FT                   /product="hypothetical protein"
FT                   /note="COG1917 Uncharacterized conserved protein, contains
FT                   double-stranded beta-helix domain"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00342"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03463"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYD5"
FT                   /protein_id="ADI03463.1"
FT                   /translation="MYSGSSGEINANFRPASTAPNVGTAGRDAIHYLATTATTRGEFGL
FT                   YRVEMSAKAGGPNTHFHKSISESFFILDGTVRLFNGAEWIDGQKGDFLHVPQGGLHAFR
FT                   NDSDAPAEMLLLFTPGAPREEYFEGLSQLADATDEERAEFFVRHDSYFVE"
     gtgtattcgg gaagcagcgg cgagatcaac gccaacttcc gaccggcgag caccgcaccg        60
     aatgtcggca cagccggccg agatgccatt cactatctgg cgaccaccgc caccactcga       120
     ggtgaattcg gtctctaccg ggtcgagatg agcgccaagg ccggcggccc caacactcac       180
     ttccacaagt ccatctcgga gtccttcttc atcctcgacg gcaccgttcg cctcttcaac       240
     ggcgcggagt ggatcgacgg gcaaaaaggc gactttctgc atgtgccgca gggcgggctt       300
     catgcctttc gcaacgactc cgacgcaccg gctgaaatgc tgctgctctt cactccgggc       360
     gcgccgcgtg aagagtattt cgagggactg tcgcagctcg ccgatgccac ggacgaggag       420
     cgcgccgagt tcttcgtgag gcacgactcg tacttcgtgg agtaa                       465
//

If you have problems or comments...

PBIL Back to PBIL home page