(data stored in ACNUC7421 zone)

EMBL: CP002047.PE343

CP002047.PE343       Location/Qualifiers
FT   CDS_pept        complement(404681..406030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00343"
FT                   /product="dehydrogenase"
FT                   /note="COG1252 NADH dehydrogenase, FAD-containing subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00343"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03464"
FT                   /db_xref="GOA:D7BYD6"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYD6"
FT                   /protein_id="ADI03464.1"
FT                   /translation="MREILIVGGGYAGFYTAWGLEKKLRRGEARVTVVDPRPYMTYQPF
FT                   LPEVLAGSVEARHAAVSLRRHLRRTRVIAGTVTEIRNSGRTVTVRPERGPDYQLNYDML
FT                   VVTAGAVTRTFPIPGLSEQAFGLKHVEEAVAIRDRLLTSFDRAAALPRGPERQKLLTVT
FT                   FVGGGFSGVEGFGELLSLAAALLKHYPELDARELDFHLVEARGRILPEVTDEPGAWVVR
FT                   SLERRGAKVHLNTQLDSAEDGHVVLSNGQEYESGLIVWAAGNASNPTVHNHTDLPVDER
FT                   GLLVVRADLRVGTDTEAVPDVWAAGDDAAVPDLAAGRAGAHTVPNAQHAVRQGKRLAKN
FT                   IVATLHGRSTKNYVHHSLGVVATLGMGRGISQYRRLVIKGLPAWLMHRGYHVLAVPTWE
FT                   RKIRVLAVWLTAALYGRDIVSLASVQRPREAFVSRGNPRNSDEPAEMKAR"
     gtgcgtgaga tcctgatcgt cggcggcggt tacgcgggct tctacacagc gtggggcctt        60
     gagaagaagc tgcgccgcgg ggaggcgcgg gtcaccgttg tcgacccgcg tccgtatatg       120
     acgtaccagc cgtttctgcc cgaggtcctg gcggggtccg tggaggcccg ccacgccgcc       180
     gtgtcactgc ggcggcatct gcgccgtacc cgggtgatcg cgggaacggt gacggagatc       240
     cgcaacagtg gtcggaccgt caccgtccgg ccggagcgcg ggccggacta tcagctgaac       300
     tacgacatgc tcgtggtgac agcgggggcg gtcacccgca ccttcccgat accggggctc       360
     agtgagcagg cgtttggtct gaagcatgtc gaagaggccg tcgccatccg tgaccggctg       420
     ctgacctcct tcgaccgggc ggccgcactg ccacgcgggc ccgagcgcca gaagctgctc       480
     acggtcacgt tcgtcggggg cggcttctcc ggtgtggagg gtttcggcga gttgctgtcc       540
     ctggcggccg cgctgttgaa gcactacccg gaactcgacg cccgagagct cgacttccac       600
     ctggtcgagg cgcgcggccg aatccttccc gaggtcaccg acgaacccgg tgcgtgggtg       660
     gtccggtcct tggagcggcg aggggcgaag gtgcatctga acacccagct cgactcggcc       720
     gaggacggcc acgtcgtgct ctccaacggg caggagtacg agtcgggcct gatcgtctgg       780
     gccgccggca acgcgtcgaa ccccaccgtc cacaaccaca ccgaccttcc ggtcgatgag       840
     cgtggtctgc tcgtcgtacg ggccgacctg cgcgtgggta cggacacgga ggcggtgccg       900
     gacgtgtggg ccgcgggcga cgacgctgcc gtaccggacc tcgcggcggg ccgggcggga       960
     gcacataccg tgcccaacgc ccagcacgcc gtacggcagg gcaagcgcct ggcgaagaac      1020
     atcgtggcga cgttgcacgg gcggagcacc aagaactacg tccaccacag cctgggcgtg      1080
     gtggccacgc tgggtatggg gcggggcatc tcccagtacc ggcgcctcgt catcaagggc      1140
     ttgcccgcct ggctcatgca ccgcggctac cacgtgctcg ccgtgccgac gtgggaacgc      1200
     aagatccgcg tcctcgccgt ctggctcacc gccgccctct acgggcggga catcgtctcg      1260
     ctggcctcgg tgcagcgccc ccgggaagcc tttgtatccc ggggcaaccc ccgtaatagt      1320
     gacgagcctg ccgagatgaa ggctcggtga                                       1350
//

If you have problems or comments...

PBIL Back to PBIL home page