(data stored in ACNUC7421 zone)

EMBL: CP002047.PE344

CP002047.PE344       Location/Qualifiers
FT   CDS_pept        complement(406114..406767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00344"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00344"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03465"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYD7"
FT                   /protein_id="ADI03465.1"
FT                   /translation="MVSVAHTAQSIEITAENLQEELRRLEVQRQALERELAAVVAHLGS
FT                   VRTTLNALQDLMQVATLASGEAAVGVAVPKPVRAKVTEAVEPTPSGPTPSGPAPAPDGA
FT                   AVVRAEPEARPQRPEGQQKQQKQQKQQKPARTARRGERGDRQTDGKYGRLTEQIMDFFA
FT                   GTGGADVRARDVAAALGRDTDAGSINAVRSTLDRLVATSRVQRAGRGLYRANPS"
     atggtctcgg tagcccacac ggcacagagc attgagatca ccgcagagaa cctgcaggag        60
     gagctgcgtc gcctggaggt ccagcggcag gccctggagc gggagttggc cgcggtggtg       120
     gcgcatctcg gctcggtgcg gacgaccctg aacgctctcc aggacctgat gcaggtggcg       180
     acgctcgcgt ccggcgaggc tgccgtgggt gtggccgtcc cgaagccggt gcgggcaaag       240
     gtcaccgagg cggttgagcc caccccgtcc ggccccaccc cgtccggccc cgctccggcg       300
     ccggacggtg cagcggtcgt acgggcggag cccgaggccc ggccgcagcg gcctgaagga       360
     cagcagaagc agcaaaagca gcagaagcag caaaagccgg cgcgcaccgc acggcgcggc       420
     gagcgtggcg atcggcagac cgacgggaag tacggcaggc tcaccgaaca gatcatggat       480
     ttcttcgcgg gcaccggtgg cgccgatgtc cgtgcgcgtg acgtcgccgc cgcactcgga       540
     cgggacaccg acgccggcag catcaacgcc gtgcgcagca cgctcgaccg gcttgtcgcg       600
     acctcgcgcg tccagcgcgc ggggcgcggt ctgtaccgcg ccaatccgtc ctga             654
//

If you have problems or comments...

PBIL Back to PBIL home page