(data stored in ACNUC7421 zone)

EMBL: CP002047.PE346

CP002047.PE346       Location/Qualifiers
FT   CDS_pept        complement(407535..408038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00346"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03467"
FT                   /db_xref="GOA:D7BYD9"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYD9"
FT                   /protein_id="ADI03467.1"
FT                   /translation="MIALIVVVFVLAVACFVAGAKSSAGSTSNAVLSRRTGWLVYGVLL
FT                   VALGLYLVNVYREQTWSDGEVGAVAREAAEAVDGATYASAYTVHDAVEDHLRRAAKGKG
FT                   AWEDLHVLNQGLDFTVFAEEDGPAHCIQVTTTDATVGGAGTTGSGTGTVEGVRVSATVS
FT                   DGRC"
     gtgatcgccc tcatcgtcgt cgtcttcgta ttggcggtgg cgtgtttcgt cgccggtgcg        60
     aagagctccg ccggctcgac gagcaacgcc gtcctctccc ggcggacagg atggctggtc       120
     tacggagtgc ttctggtggc cctgggcctg tatctggtga acgtgtaccg ggagcagacg       180
     tggagcgatg gcgaggtcgg ggcggtggcg cgggaggcgg ccgaggccgt cgacggggcc       240
     acgtacgcca gtgcgtacac cgtccatgac gcggtggagg accacttgcg gcgcgcggcc       300
     aagggcaagg gggcgtggga agacctgcat gtgctcaacc aggggctgga cttcacggtt       360
     ttcgccgaag aggacggacc cgctcactgc atccaggtga ccacgaccga cgccaccgtc       420
     ggtggcgcgg gaaccactgg ttcaggcacc gggaccgtcg agggggtccg ggtgtccgcc       480
     acggtgtccg acggacggtg ctag                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page