(data stored in ACNUC7421 zone)

EMBL: CP002047.PE35

CP002047.PE35        Location/Qualifiers
FT   CDS_pept        complement(34040..34285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00035"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03156"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSX9"
FT                   /protein_id="ADI03156.1"
FT                   /translation="MPERVGNVTRERYEQIVAAARQLVAQITRTQFTLGDKTLEIEPMR
FT                   PVGGAMPNGTEDLFTVEESFALFAEDIEVAPSTVKD"
     gtgccggagc gcgtcgggaa tgtcacgcgg gagcgttacg agcagatcgt tgccgcggcc        60
     cggcagttgg tcgcgcagat cacgcggacc cagttcacgc tgggagacaa gaccctggag       120
     atcgagccga tgcggccagt gggcggggcg atgccgaacg gcaccgagga cctgttcacg       180
     gtcgaggagt cgttcgcgct gtttgccgaa gacattgaag tggccccgtc cacggtgaag       240
     gactga                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page