(data stored in ACNUC7421 zone)

EMBL: CP002047.PE356

CP002047.PE356       Location/Qualifiers
FT   CDS_pept        420695..422023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00356"
FT                   /product="hypothetical protein"
FT                   /note="COG2755 Lysophospholipase L1 and related esterases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00356"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03477"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYE9"
FT                   /protein_id="ADI03477.1"
FT                   /translation="MPATVLPIVMLVSGAQGAERSEAHTAPAGGSAGAAPPAGTHWVGT
FT                   WAAMPQLTEPGNMPPAPYTQDGTVLADSTLRQTVHISVGGNHLRLRFSNAFGGAPLPIT
FT                   RVSVALPMNGRAGVSTIKPGTSRPVTFHGRTSTTVPTGAQVVSDPLDFELAAGSNLTVT
FT                   AYLATGQQSTAITSHPGSRTTSYLLRGDHVEATDLAGAASVDHWYFLSGVETWSPARTR
FT                   ATAVLGDSLTDGRGSTTNQNDRWTDRLMTRLRTDRRTADTAVLNQAAGGNRVLTDGLGP
FT                   GGLSRVDRDVLVQPGVTSLIVFEGVNDIGTAPATPDAQKDVADRLIAAYDQIIMRAHAQ
FT                   GIRVYGATITPFGGNHDYDDAAGHREATRQRVNDWIRTSGRFDAVVDLDRAARDNDDPR
FT                   RLRPDLDVGDHLHFNPDGYRVLGDAFPLALFVNRPLPPGFGYN"
     gtgcccgcca ccgttctgcc catcgtgatg ctggtgtccg gcgcccaagg ggccgagcgg        60
     agcgaggcgc acaccgcacc ggccggggga agcgcgggcg ccgcgccgcc cgcgggcacc       120
     cactgggtgg gcacctgggc cgccatgccc cagctgaccg agccgggaaa catgccgccc       180
     gcgccgtaca cccaggacgg cacggtcctc gccgacagca cactccggca gaccgtgcat       240
     atatcggtgg gcggcaacca tctgcggctc cgcttctcca atgccttcgg cggcgcgcca       300
     ctgcccatca cccgcgtctc cgtggccctt cccatgaacg gccgggccgg tgtgagcacg       360
     atcaaaccgg gcacgtcccg gcccgtcacc ttccacggcc gtacctcgac gacggtgccg       420
     acgggcgcac aggtggtgtc cgaccccctg gacttcgagc tggcggcggg ctcgaacctc       480
     accgtgaccg catacctggc cacgggccag cagtcgaccg ccatcacctc ccaccccggt       540
     tcgcgcacca cctcgtacct gctgcgcggc gaccacgtcg aggccaccga cctggcgggg       600
     gcggcctcgg tcgaccactg gtacttcctg agcggcgtcg agacatggtc gccggcgcgg       660
     acccgggcca ccgccgtgct gggcgactcg ctcaccgacg ggaggggttc gaccaccaac       720
     cagaacgacc gctggacgga ccggctgatg acccgtctgc gcaccgaccg caggacggcc       780
     gacacggcgg tgctcaacca ggcggccggc gggaaccggg tgctcacgga cgggttgggt       840
     ccgggcggcc tctcccgtgt ggaccgtgac gtactggtgc agcccggcgt cacctctctg       900
     atcgtcttcg aaggcgtcaa cgacatcggg accgcccctg ccacccccga cgcccagaag       960
     gacgtcgcgg accggctcat cgccgcgtac gaccagatca tcatgcgcgc ccacgcgcag      1020
     gggatccgcg tctacggggc caccatcaca ccgttcggtg gcaaccacga ctacgacgac      1080
     gcggcgggcc accgcgaggc gacacggcag cgggtcaatg actggatacg tacgagcggt      1140
     cgcttcgacg cggtcgtgga cctcgacagg gcggcccggg acaacgacga tccacggcgc      1200
     ctccgcccgg acctcgacgt gggtgaccat ctgcacttca accccgacgg ttaccgcgtg      1260
     ctcggcgacg ccttcccctt ggccctcttc gtgaaccggc cactgccacc cggcttcggc      1320
     tacaactga                                                              1329
//

If you have problems or comments...

PBIL Back to PBIL home page