(data stored in ACNUC7421 zone)

EMBL: CP002047.PE357

CP002047.PE357       Location/Qualifiers
FT   CDS_pept        complement(422115..422630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00357"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00357"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03478"
FT                   /db_xref="GOA:D7BYF0"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYF0"
FT                   /protein_id="ADI03478.1"
FT                   /translation="MHDDDEAPRPDGRAAPYGHEETREERADRRWSELLQEVRVTQTGM
FT                   QILFAFLLTVAFTPRFQSLSHADRTIYVVTVLLGAAANGALIAPVPLHRIVTGRRLKPE
FT                   TVHIAARFTMAGLVLLVCTVVSALLLILRVVVADVTALWLTVAALVWFAGCWIAPAVWL
FT                   FHRHRKER"
     atgcatgacg acgacgaagc gccgaggccc gacggccgtg cagcaccgta cggtcacgag        60
     gagacccggg aagagcgggc cgaccgccga tggtccgaat tgcttcagga ggtgagggtg       120
     acgcagacgg gcatgcagat cctgttcgcc tttctgctca cggtcgcctt caccccacgc       180
     ttccagagcc tgagccacgc ggatcggacc atatacgtgg tcacggttct cctgggcgcg       240
     gcggccaacg gcgcgctcat cgcaccggtc cccttgcacc ggatcgtcac cgggcgccgg       300
     ctgaagccgg agacggtgca tattgcggcc cgcttcacca tggccgggct ggtgctgctg       360
     gtgtgcacgg tggtgtcggc gctgctgctg atcctgcgcg tcgtcgtagc cgatgtcacc       420
     gcgctctggc tcacggtcgc ggccctggtg tggttcgcgg gctgctggat cgcccccgcg       480
     gtctggctct tccatcgcca ccgcaaggag cgctga                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page