(data stored in ACNUC7421 zone)

EMBL: CP002047.PE358

CP002047.PE358       Location/Qualifiers
FT   CDS_pept        complement(422654..422818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00358"
FT                   /product="hypothetical protein"
FT                   /note="COG3387 Glucoamylase and related glycosyl
FT                   hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00358"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03479"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYF1"
FT                   /protein_id="ADI03479.1"
FT                   /translation="MGPRGEVVWLCTQPLEPAATTSLPERAGARRDDDHRFAWSAQMPE
FT                   TAARLGIRR"
     gtgggacccc gtggcgaggt ggtgtggctg tgcacgcagc ccctcgaacc cgccgccacc        60
     acctcgctcc cggagcgggc cggcgcccgc cgcgacgacg accaccgctt cgcctggtcc       120
     gcccagatgc cggaaacggc ggcccgcctc gggataaggc ggtag                       165
//

If you have problems or comments...

PBIL Back to PBIL home page