(data stored in ACNUC7421 zone)

EMBL: CP002047.PE360

CP002047.PE360       Location/Qualifiers
FT   CDS_pept        complement(424013..425662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00360"
FT                   /product="serine/threonine protein kinase"
FT                   /note="COG0515 Serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00360"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03481"
FT                   /db_xref="GOA:D7BYF3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYF3"
FT                   /protein_id="ADI03481.1"
FT                   /translation="MSYGSDSGGRAGRAGIEGWLIGGRYRIAERIGSGGMGTVWRAHDE
FT                   LVDREVAVKQPKISGDPEDPTFHRTAERLYREARAAARVEHPAAVAIHDVVVEDGLPWI
FT                   VMELVRGEALDKVLRRGALPPAEAARIGLAVVDALSAAHSVGVIHRDVKPANVLLGQNG
FT                   RVVLTDFGIAQIQGEESLTASGEFVGSIEFIAPERMSGRGAGAAADLWSLGVVLYAAVQ
FT                   GWSPFRRDTLESTLAAILAAEPPEPERAGPLGPLILRLLAKEPDLRANAEEAAATLRAV
FT                   AEGRPSPYGPEPLVATQHGRQLEEFGESRGKAGQTGGAGAPPAAVTPSHAHTTGPAPKR
FT                   PYTTGQLLAIALVGVLAVGGAVWAGVTAGDDGASSVAEKTTGPSTSGSPSPRPGTWTAH
FT                   REKQLDAIVSVPAGTLEYDRSDSGADRRNPSQWVAYGDKTVQLRLTRKEAVPTTIKEWA
FT                   SEATLSWADDNAQTLYAPTSFHGYEAMATDTTYEVKDKKYRAMQLLITTSAQEHYELRV
FT                   DMPKGGKDESRGHLLFTGARARLKVGKAMVSP"
     atgagctacg gcagcgacag cggtggacgc gcgggacgcg cgggaatcga ggggtggctg        60
     ataggcggcc gttaccggat cgccgagcgt atcggctccg gtggcatggg taccgtatgg       120
     cgggcgcatg atgagctcgt cgaccgtgag gtcgccgtca agcagccgaa aatctccggc       180
     gaccccgagg atcccacctt ccaccggacc gccgaacgcc tctaccgcga ggcccgcgcc       240
     gccgcgcgcg tcgagcatcc cgccgcggtc gccatccatg acgtggtcgt cgaggacggg       300
     ttgccctgga tcgtcatgga gttggtccgt ggcgaggccc tggacaaggt gttgcggcgc       360
     ggggctctgc cgcccgccga ggccgcgcgg atcggtctcg ccgtcgtgga cgccctgtcg       420
     gccgcgcact cagtcggcgt catccaccgc gatgtgaaac ccgcgaacgt gctgctcgga       480
     cagaacggcc gcgtcgtgct caccgacttc ggtatcgcac agatccaggg agaggaatcc       540
     ctcacggcca gcggggagtt cgtcggatcg atcgagttca tcgccccgga gcggatgtcg       600
     ggccgcggcg ccggtgcggc ggccgatctg tggtccctgg gcgtggtgct gtacgcggcc       660
     gtccagggct ggtctccctt ccggcgggac acgctcgagt ccacgctcgc cgcgatcctg       720
     gccgccgagc cgcccgagcc cgagcgggcg gggccgctcg ggcccctgat cctgcggctc       780
     ctcgccaagg agccggacct gcgcgccaac gcggaggagg ccgcggccac gctgcgggcg       840
     gtggccgagg ggcggccctc accgtatggc cccgagccgt tggtggcgac ccagcacggc       900
     cggcagctgg aggagttcgg ggagagcagg gggaaggcgg ggcagacggg tggggccggc       960
     gcgccgcccg ccgcggtcac gccctctcac gcccacacca ccggccccgc ccccaagcgc      1020
     ccgtacacca ccggacagct gctcgccatc gccctggtcg gcgtgctggc cgtcgggggc      1080
     gccgtctggg cgggggtcac cgcgggcgac gacggagcga gctcggtggc ggagaagacc      1140
     accggcccga gcacgagcgg cagcccgtcg ccgcgccccg gcacctggac ggcccaccgc      1200
     gagaagcaac ttgacgcgat cgtgtcggtg cccgccggca ccctcgagta cgaccgctcg      1260
     gactccggcg cggaccgccg gaacccctcc cagtgggtgg cctacggcga caagaccgtc      1320
     cagctccggc tgacccgcaa ggaggcggtg cccacgacca tcaaggagtg ggcgtcggag      1380
     gccaccttgt cctgggcgga cgacaatgcc cagacgctgt acgcccccac cagcttccac      1440
     ggctatgagg ccatggccac cgacaccacg tacgaggtga aggacaagaa atatcgggcg      1500
     atgcaactgc tgatcaccac aagcgcccag gaacactacg agctgcgcgt ggacatgcct      1560
     aagggaggaa aggacgagag ccggggccac ctcctgttca caggagcccg cgcccgcctc      1620
     aaggtcggca aggccatggt gagcccctga                                       1650
//

If you have problems or comments...

PBIL Back to PBIL home page