(data stored in ACNUC7421 zone)

EMBL: CP002047.PE362

CP002047.PE362       Location/Qualifiers
FT   CDS_pept        complement(426555..427409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00362"
FT                   /product="ABC-type drug export system, ATP-binding protein"
FT                   /note="COG1131 ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00362"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03483"
FT                   /db_xref="GOA:D7BYF5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYF5"
FT                   /protein_id="ADI03483.1"
FT                   /translation="MTDVRETTAVPALVCEGLRYAFGETKAVDGLELSVRPGEVFGLLG
FT                   PNGAGKTTAIRCITTLLPVPAGMVRVFGHDAAKERMAVRRLLGYVPQQLSADAGLTGRE
FT                   NVELFARVFDVTRRERAARVARALEAVDLTAAADRLAKTYSGGMVRRLELAQALVSAPR
FT                   LLMLDEPTIGLDPIARTSVWEHINAVRTATGMTVLVTTHYMDEADQYCDRVALMHRGRI
FT                   HALGTPEELRSELADRRRAEGKTDPDPTLEDVFRDVAGSGLDEQGGDFRDVRSTRRTAS
FT                   RVG"
     atgaccgacg tccgggaaac caccgctgtg cccgcgctcg tctgcgaggg gctgcggtat        60
     gcgttcgggg agaccaaggc ggtcgacggc ctggagctgt cggtccggcc gggcgaggtc       120
     ttcgggctgc tcggacccaa cggggcgggc aagaccaccg cgatccgctg catcaccacc       180
     ctgctgccgg tccccgccgg catggtgcgg gtgttcgggc acgacgcggc gaaggagcgg       240
     atggcggtcc gccggctgct gggctacgta ccgcagcagc tgtccgccga cgccgggctc       300
     accggccggg agaacgtgga gctgttcgcc cgcgtcttcg atgtcacccg ccgggagcgc       360
     gccgcccgtg tggcgcgggc gctggaggcg gtcgatctca ccgcagcggc cgaccggctc       420
     gccaagacgt actccggcgg catggtccgc cgcctcgaac tggcccaggc cctggtcagc       480
     gccccccggc tgctgatgct ggacgagccg acgatcggcc tcgacccgat cgcccggacc       540
     agcgtatggg agcacatcaa cgcggtacgg acggccaccg ggatgaccgt gctggtcacc       600
     acgcactaca tggacgaggc cgaccagtac tgcgaccggg tcgcgctgat gcaccgcggc       660
     cggatccacg ccctcggaac gccggaggaa ctccgctccg agctggccga ccgccgccgg       720
     gcggagggga agaccgatcc cgacccgacc ctggaggacg tcttccggga cgtcgccggc       780
     agcggtctcg atgagcaggg aggagacttc cgcgatgtcc gaagcacccg tcgcaccgcg       840
     tcacgggtcg gctga                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page