(data stored in ACNUC7421 zone)

EMBL: CP002047.PE363

CP002047.PE363       Location/Qualifiers
FT   CDS_pept        complement(427406..427861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00363"
FT                   /product="transcriptional regulator, MarR family protein"
FT                   /note="COG1846 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00363"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03484"
FT                   /db_xref="GOA:D7BYF6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYF6"
FT                   /protein_id="ADI03484.1"
FT                   /translation="MATEDFPDSFADVLAGVQRLIRRRLRAGMTEPRLRGAQVDLLRLV
FT                   VACPRIRVSAAAKELYLAGNSVSTLVNQLVKAGYLHRETDPEDRRSGLLTATPAAEARL
FT                   RVWQVRRGALVREQVARLSESDRAALAAAVPALRKLAENLHEEVDGI"
     atggccacag aggatttccc cgactcgttc gccgatgtgc tggccggagt ccagcggctg        60
     atccggcggc ggctgcgggc cgggatgacg gagccgcggc tgcgcggtgc ccaggtggac       120
     ctgttgcggc tggtcgtggc ctgtccccgg atccgggtgt cggccgcggc caaggagctc       180
     tacctcgcgg gcaactcggt ctccaccctg gtcaaccagc tggtgaaggc cggctatctg       240
     caccgcgaga ccgaccccga ggaccggcgc tccgggctgc tgacggccac ccccgccgcc       300
     gaggcccggc tgcgggtgtg gcaggtacgg cgcggcgcgc tggtccgcga gcaggtggcg       360
     cggctgtccg agagcgaccg ggcggcgctg gccgccgccg ttccggcgct gcgcaaactg       420
     gccgagaacc ttcatgagga ggtggatggg atatga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page